Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4765
Gene name
LocationContig_33:44662..46490
Strand-
Gene length (bp)1828
Transcript length (bp)1719
Coding sequence length (bp)1719
Protein length (aa) 573

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10361 DUF2434 Protein of unknown function (DUF2434) 1.0E-132 44 337

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10260|YD2C_SCHPO Uncharacterized protein C56F8.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC56F8.12 PE=4 SV=1 32 381 2.0E-20

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 90 112 22
2 132 154 22
3 164 186 22
4 216 238 22
5 263 285 22
6 305 327 22
7 347 369 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4765
MKTFDVFDARDLIALPGGDNDTDTVFEGVHFNVTTLNHWNYTHYSNGTLSNGSNCWLTFAPYQPKLLLNNGTFVN
ATRCWSAIDPIGLRGYIGIGFAAAYGIALVLTLTALTKHGRLYLPKETRFYPIGRRWQWYWACFTCACALISLFT
NIDVDRYYVQELPIIIHVFFWYLVCMGTLALVWESVRHWNSWLERQFIDPNPFIYRDDDRRASIEFWLPLWFYFW
VWMNFFLVVPRSWNFAKLQRSPDQTRDIAIPSATSTRFKAGAFCLVVAWLTIFYSIRHSINHYKPRNRGIYNRAV
GLVRAVPPRFMLTLPLALCLIAYQILMSFDWNVSLIRVGAVLPIMYAWGYGPSLLIILIQIVYGFVSPNEDKALI
RQRRERGDAINRELGLVKKPAWWRRVRGDHLYSLRDKIMRNVHEVGERGVGRRIEGEAERQIRLENEALALENHD
DVELANIARQTSDSDGCIDRPAAKMGQASYTGKSNSRHAERLVQTAATVLFPADADAETQRQQRVAYLMTDGPPP
PPYSDGSPANSPTDQDANANVAHRTNSSSTTNSATSPPQQVRSMLDI*
Coding >OphauB2|4765
ATGAAGACTTTTGACGTCTTTGACGCCCGCGACCTCATCGCCCTCCCCGGCGGCGACAACGACACCGACACCGTA
TTCGAAGGCGTCCACTTCAACGTCACCACGCTCAACCACTGGAACTACACGCACTACAGCAACGGCACCCTGTCC
AACGGCTCCAACTGCTGGCTCACTTTTGCCCCCTACCAGCCCAAGCTCCTCCTCAACAATGGCACCTTTGTCAAT
GCCACGCGCTGCTGGAGCGCCATTGACCCCATTGGCCTGCGCGGATACATTGGCATCGGCTTCGCTGCCGCCTAT
GGCATCGCCCTCGTCTTGACCCTTACCGCCCTGACAAAGCACGGCAGGCTCTACTTGCCCAAGGAGACGCGCTTT
TATCCCATTGGTCGTCGCTGGCAGTGGTACTGGGCTTGCTTCACCTGCGCCTGTGCCCTCATTAGCCTCTTTACC
AATATCGACGTTGATCGCTACTATGTCCAGGAGCTGCCCATTATTATCCACGTCTTTTTTTGGTATCTCGTCTGC
ATGGGCACTCTGGCGCTCGTTTGGGAGTCGGTTCGGCACTGGAACAGCTGGCTGGAACGGCAGTTTATCGATCCC
AACCCCTTCATCTATCGCGACGACGATCGCCGTGCCAGCATTGAGTTTTGGCTGCCCTTGTGGTTTTACTTTTGG
GTCTGGATGAACTTCTTCCTCGTCGTCCCGCGCAGCTGGAACTTTGCCAAACTCCAACGCTCCCCCGACCAGACC
CGCGACATTGCCATTCCCAGCGCCACCAGCACCCGCTTCAAGGCTGGCGCCTTTTGTCTCGTTGTTGCCTGGCTC
ACAATCTTTTACTCGATCCGCCACTCCATCAACCACTACAAGCCTCGCAACCGCGGCATCTACAACCGCGCCGTC
GGCCTTGTCCGCGCCGTGCCCCCGCGCTTCATGCTCACTCTTCCCCTTGCCCTCTGCCTCATTGCCTACCAGATT
CTCATGTCGTTTGACTGGAACGTGTCGCTTATTCGCGTCGGTGCCGTCTTGCCAATCATGTATGCTTGGGGCTAT
GGGCCGTCGCTGCTTATTATTTTGATTCAAATCGTCTATGGCTTCGTCTCGCCAAATGAGGACAAGGCCCTGATT
CGTCAGCGGCGGGAGCGCGGGGATGCTATTAATCGCGAACTCGGCCTTGTCAAGAAACCGGCCTGGTGGCGGCGT
GTGCGTGGCGATCATCTTTATTCGTTGCGCGACAAGATTATGCGCAATGTGCACGAGGTGGGCGAGCGAGGCGTC
GGCCGGCGCATCGAGGGGGAGGCTGAGCGGCAGATTCGTCTGGAGAATGAAGCCCTGGCTCTCGAAAATCACGAC
GACGTGGAACTCGCAAATATTGCTCGCCAGACGAGCGACAGTGATGGGTGCATCGACCGCCCCGCTGCCAAGATG
GGGCAGGCCTCATATACTGGCAAATCCAATTCTCGCCATGCCGAGCGTCTTGTCCAGACTGCTGCCACGGTCCTC
TTTCCCGCCGATGCAGACGCCGAAACGCAGCGACAGCAGCGCGTCGCCTATCTCATGACGGATGGACCTCCACCA
CCGCCATATAGTGATGGCTCACCTGCAAACTCTCCCACTGATCAAGATGCAAATGCCAATGTGGCTCATCGTACA
AATAGCTCCTCGACTACCAATTCAGCCACCTCGCCGCCGCAACAAGTCCGCAGCATGCTCGATATATGA
Transcript >OphauB2|4765
ATGAAGACTTTTGACGTCTTTGACGCCCGCGACCTCATCGCCCTCCCCGGCGGCGACAACGACACCGACACCGTA
TTCGAAGGCGTCCACTTCAACGTCACCACGCTCAACCACTGGAACTACACGCACTACAGCAACGGCACCCTGTCC
AACGGCTCCAACTGCTGGCTCACTTTTGCCCCCTACCAGCCCAAGCTCCTCCTCAACAATGGCACCTTTGTCAAT
GCCACGCGCTGCTGGAGCGCCATTGACCCCATTGGCCTGCGCGGATACATTGGCATCGGCTTCGCTGCCGCCTAT
GGCATCGCCCTCGTCTTGACCCTTACCGCCCTGACAAAGCACGGCAGGCTCTACTTGCCCAAGGAGACGCGCTTT
TATCCCATTGGTCGTCGCTGGCAGTGGTACTGGGCTTGCTTCACCTGCGCCTGTGCCCTCATTAGCCTCTTTACC
AATATCGACGTTGATCGCTACTATGTCCAGGAGCTGCCCATTATTATCCACGTCTTTTTTTGGTATCTCGTCTGC
ATGGGCACTCTGGCGCTCGTTTGGGAGTCGGTTCGGCACTGGAACAGCTGGCTGGAACGGCAGTTTATCGATCCC
AACCCCTTCATCTATCGCGACGACGATCGCCGTGCCAGCATTGAGTTTTGGCTGCCCTTGTGGTTTTACTTTTGG
GTCTGGATGAACTTCTTCCTCGTCGTCCCGCGCAGCTGGAACTTTGCCAAACTCCAACGCTCCCCCGACCAGACC
CGCGACATTGCCATTCCCAGCGCCACCAGCACCCGCTTCAAGGCTGGCGCCTTTTGTCTCGTTGTTGCCTGGCTC
ACAATCTTTTACTCGATCCGCCACTCCATCAACCACTACAAGCCTCGCAACCGCGGCATCTACAACCGCGCCGTC
GGCCTTGTCCGCGCCGTGCCCCCGCGCTTCATGCTCACTCTTCCCCTTGCCCTCTGCCTCATTGCCTACCAGATT
CTCATGTCGTTTGACTGGAACGTGTCGCTTATTCGCGTCGGTGCCGTCTTGCCAATCATGTATGCTTGGGGCTAT
GGGCCGTCGCTGCTTATTATTTTGATTCAAATCGTCTATGGCTTCGTCTCGCCAAATGAGGACAAGGCCCTGATT
CGTCAGCGGCGGGAGCGCGGGGATGCTATTAATCGCGAACTCGGCCTTGTCAAGAAACCGGCCTGGTGGCGGCGT
GTGCGTGGCGATCATCTTTATTCGTTGCGCGACAAGATTATGCGCAATGTGCACGAGGTGGGCGAGCGAGGCGTC
GGCCGGCGCATCGAGGGGGAGGCTGAGCGGCAGATTCGTCTGGAGAATGAAGCCCTGGCTCTCGAAAATCACGAC
GACGTGGAACTCGCAAATATTGCTCGCCAGACGAGCGACAGTGATGGGTGCATCGACCGCCCCGCTGCCAAGATG
GGGCAGGCCTCATATACTGGCAAATCCAATTCTCGCCATGCCGAGCGTCTTGTCCAGACTGCTGCCACGGTCCTC
TTTCCCGCCGATGCAGACGCCGAAACGCAGCGACAGCAGCGCGTCGCCTATCTCATGACGGATGGACCTCCACCA
CCGCCATATAGTGATGGCTCACCTGCAAACTCTCCCACTGATCAAGATGCAAATGCCAATGTGGCTCATCGTACA
AATAGCTCCTCGACTACCAATTCAGCCACCTCGCCGCCGCAACAAGTCCGCAGCATGCTCGATATATGA
Gene >OphauB2|4765
ATGAAGACTTTTGACGTCTTTGACGCCCGCGACCTCATCGCCCTCCCCGGCGGCGACAACGACACCGACACCGTA
TTCGAAGGCGTCCACTTCAACGTCACCACGCTCAACCACTGGAACTACACGCACTACAGCAACGGCACCCTGTCC
AACGGCTCCAACTGCTGGCTCACTTTTGCCCCCTACCAGCCCAAGCTCCTCCTCAACAATGGCACCTTTGTCAAT
GCCACGCGCTGCTGGAGCGCCATTGACCCCATTGGCCTGCGCGGATACATTGGCATCGGCTTCGCTGCCGCCTAT
GGCATCGCCCTCGTCTTGACCCTTACCGCCCTGACAAAGCACGGCAGGCTCTACTTGCCCAAGGAGACGCGCTTT
TATCCCATTGGTCGTCGCTGGCAGTGGTACTGGGCTTGCTTCACCTGCGCCTGTGCCCTCATTAGCCTCTTTACC
AATATCGACGTTGATCGCTACTATGTCCAGGAGCTGCCCATTATTATCCACGTCTTTTTTTGGTATCTCGTCTGC
ATGGGCACTCTGGCGCTCGTTTGGGAGTCGGTTCGGCACTGGAACAGCTGGCTGGAACGGCAGTTTATCGATCCC
AACCCCTTCATCTATCGCGACGACGATCGCCGTGCCAGCATTGAGTTTTGGCTGCCCTTGTGGTTTTACTTTTGG
GTCTGGATGGTATGCGCAGCGCCCTCTTAACCCACCACATCTCCTCTCTCTCTCCCCTTTTTACCCTCCCATACT
TGGCGCCACTATATACTCTCCCATCTTACTGACTTGTCTGCAGAACTTCTTCCTCGTCGTCCCGCGCAGCTGGAA
CTTTGCCAAACTCCAACGCTCCCCCGACCAGACCCGCGACATTGCCATTCCCAGCGCCACCAGCACCCGCTTCAA
GGCTGGCGCCTTTTGTCTCGTTGTTGCCTGGCTCACAATCTTTTACTCGATCCGCCACTCCATCAACCACTACAA
GCCTCGCAACCGCGGCATCTACAACCGCGCCGTCGGCCTTGTCCGCGCCGTGCCCCCGCGCTTCATGCTCACTCT
TCCCCTTGCCCTCTGCCTCATTGCCTACCAGATTCTCATGTCGTTTGACTGGAACGTGTCGCTTATTCGCGTCGG
TGCCGTCTTGCCAATCATGTATGCTTGGGGCTATGGGCCGTCGCTGCTTATTATTTTGATTCAAATCGTCTATGG
CTTCGTCTCGCCAAATGAGGACAAGGCCCTGATTCGTCAGCGGCGGGAGCGCGGGGATGCTATTAATCGCGAACT
CGGCCTTGTCAAGAAACCGGCCTGGTGGCGGCGTGTGCGTGGCGATCATCTTTATTCGTTGCGCGACAAGATTAT
GCGCAATGTGCACGAGGTGGGCGAGCGAGGCGTCGGCCGGCGCATCGAGGGGGAGGCTGAGCGGCAGATTCGTCT
GGAGAATGAAGCCCTGGCTCTCGAAAATCACGACGACGTGGAACTCGCAAATATTGCTCGCCAGACGAGCGACAG
TGATGGGTGCATCGACCGCCCCGCTGCCAAGATGGGGCAGGCCTCATATACTGGCAAATCCAATTCTCGCCATGC
CGAGCGTCTTGTCCAGACTGCTGCCACGGTCCTCTTTCCCGCCGATGCAGACGCCGAAACGCAGCGACAGCAGCG
CGTCGCCTATCTCATGACGGATGGACCTCCACCACCGCCATATAGTGATGGCTCACCTGCAAACTCTCCCACTGA
TCAAGATGCAAATGCCAATGTGGCTCATCGTACAAATAGCTCCTCGACTACCAATTCAGCCACCTCGCCGCCGCA
ACAAGTCCGCAGCATGCTCGATATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail