Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|476
Gene name
LocationContig_107:47018..54208
Strand-
Gene length (bp)7190
Transcript length (bp)6573
Coding sequence length (bp)6573
Protein length (aa) 2191

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 4.6E-65 11 246
PF08659 KR KR domain 5.0E-64 1823 2000
PF00698 Acyl_transf_1 Acyl transferase domain 2.1E-60 516 841
PF14765 PS-DH Polyketide synthase dehydratase 1.4E-41 895 1211
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 3.1E-38 257 373
PF00106 adh_short short chain dehydrogenase 2.4E-17 1824 1981
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 5.2E-16 1624 1742
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 1.1E-13 1671 1799
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 5.5E-11 1831 1982
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 4.3E-10 395 484
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 1.0E-06 1506 1576
PF00550 PP-binding Phosphopantetheine attachment site 1.5E-05 2111 2169

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 4 1203 0.0E+00
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 11 1208 1.0E-171
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 11 1152 2.0E-159
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 7 1152 2.0E-158
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 11 1152 3.0E-158
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 4 1203 0.0E+00
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 11 1208 1.0E-171
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 11 1152 2.0E-159
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 7 1152 2.0E-158
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 11 1152 3.0E-158
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 7 950 9.0E-141
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 10 1150 1.0E-137
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 10 1150 1.0E-137
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 10 1150 1.0E-137
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 10 1150 1.0E-137
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 12 1123 6.0E-137
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 10 1150 1.0E-136
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 11 1156 2.0E-131
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 11 1156 2.0E-131
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 11 1156 3.0E-131
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 11 1080 1.0E-130
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 11 878 9.0E-129
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1323 2178 3.0E-128
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 12 878 1.0E-124
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 4 895 2.0E-124
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 11 1080 2.0E-124
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 12 1126 6.0E-123
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 11 878 8.0E-122
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 11 878 2.0E-119
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 12 1126 1.0E-118
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 11 884 4.0E-118
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 11 1241 2.0E-117
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 11 950 2.0E-117
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 11 950 3.0E-117
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 11 950 4.0E-116
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 11 886 2.0E-114
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 11 830 1.0E-113
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 11 830 2.0E-113
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 11 830 2.0E-113
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1 948 3.0E-113
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 12 978 1.0E-109
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 12 946 4.0E-108
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 5 936 4.0E-108
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 5 936 4.0E-108
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 12 1175 1.0E-106
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1 1101 2.0E-106
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 12 1127 2.0E-106
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 12 1163 6.0E-106
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 8 1125 2.0E-105
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 12 1129 4.0E-105
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 5 1125 6.0E-105
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 12 1125 1.0E-104
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 5 946 3.0E-103
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 12 967 5.0E-102
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 12 967 2.0E-101
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 12 967 6.0E-101
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 5 1101 8.0E-100
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 12 964 2.0E-99
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 12 878 1.0E-98
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 12 941 1.0E-98
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 12 1125 2.0E-98
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 12 964 4.0E-98
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 12 954 1.0E-97
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 12 1102 1.0E-97
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 12 1117 2.0E-97
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 20 1125 4.0E-97
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 12 1098 5.0E-96
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 12 878 1.0E-95
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 2 878 2.0E-95
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 12 1098 3.0E-95
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 12 884 2.0E-94
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 12 1033 9.0E-94
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1507 2186 2.0E-92
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1507 2186 2.0E-92
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 12 1129 2.0E-88
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 3 1098 9.0E-88
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 11 411 1.0E-87
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 3 1129 2.0E-87
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 14 1150 5.0E-87
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 12 1129 2.0E-86
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 6 978 1.0E-85
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 4 1150 7.0E-82
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 12 1125 1.0E-81
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 12 1150 3.0E-81
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 12 1150 6.0E-81
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 12 1129 6.0E-80
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 12 499 8.0E-77
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 12 500 1.0E-76
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1385 2155 3.0E-76
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1385 2155 3.0E-76
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1385 2155 3.0E-76
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1385 2155 3.0E-76
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1385 2155 3.0E-76
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 12 884 7.0E-76
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 12 884 1.0E-75
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 12 884 1.0E-75
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1385 2169 3.0E-74
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 9 508 4.0E-74
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1357 2155 8.0E-74
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1504 2155 9.0E-73
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1483 2145 3.0E-71
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1483 2145 5.0E-71
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1483 2145 1.0E-70
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1 547 1.0E-70
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 12 498 3.0E-70
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 6 499 8.0E-70
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 5 567 4.0E-69
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1483 2003 1.0E-68
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1503 2186 5.0E-68
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1336 2005 2.0E-67
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 8 404 2.0E-67
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1506 2169 7.0E-67
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 3 499 8.0E-67
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 11 500 1.0E-66
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1518 2003 3.0E-66
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1518 2005 2.0E-64
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1474 2155 7.0E-63
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1509 2155 6.0E-62
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 12 498 8.0E-62
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 4 413 5.0E-58
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1504 2166 1.0E-57
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 12 413 9.0E-57
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1358 2167 5.0E-56
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1358 2167 7.0E-56
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1358 2167 2.0E-55
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 12 365 3.0E-55
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 3 498 5.0E-55
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 12 495 1.0E-54
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1495 2166 1.0E-53
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1504 2166 2.0E-53
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1358 2167 2.0E-53
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 12 498 4.0E-53
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1358 2167 5.0E-53
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 12 412 1.0E-52
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2 412 6.0E-52
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1472 2167 1.0E-51
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1226 2166 3.0E-51
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1437 2161 4.0E-51
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1362 2188 1.0E-50
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1472 2167 2.0E-50
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 12 500 1.0E-49
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1360 2176 2.0E-49
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1472 2167 2.0E-49
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1437 2161 2.0E-49
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1495 2168 3.0E-49
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1494 2146 1.0E-48
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1399 2173 4.0E-47
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1495 2166 5.0E-47
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1495 2167 1.0E-46
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1504 2152 1.0E-46
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1495 2167 2.0E-46
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1504 2152 1.0E-45
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1495 2167 4.0E-45
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1495 2167 9.0E-45
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1509 2169 1.0E-44
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1504 2171 4.0E-44
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1504 2169 4.0E-42
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1504 2166 4.0E-42
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1504 2166 5.0E-42
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1504 2169 5.0E-42
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1816 2161 2.0E-40
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1504 2166 6.0E-40
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 512 1213 4.0E-38
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 495 1125 1.0E-36
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1817 2187 3.0E-36
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1817 2187 2.0E-35
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1840 2169 8.0E-33
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 514 1103 9.0E-32
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 504 1241 3.0E-29
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 12 413 4.0E-29
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1824 2145 5.0E-29
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1782 2174 1.0E-25
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 12 413 1.0E-23
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1792 2145 2.0E-23
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 1458 1799 4.0E-23
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 1488 1799 4.0E-23
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 1477 1799 9.0E-23
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 476 890 1.0E-22
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 1768 2144 2.0E-22
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 1483 1767 2.0E-22
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 84 407 2.0E-22
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 84 407 2.0E-22
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 12 413 3.0E-22
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 12 413 3.0E-22
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 12 413 3.0E-22
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 12 413 3.0E-22
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1838 2145 1.0E-21
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 12 413 3.0E-21
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 1503 1715 7.0E-21
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 516 826 8.0E-21
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 1488 1714 8.0E-21
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 109 413 8.0E-21
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1838 2145 1.0E-20
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 86 413 1.0E-20
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 84 407 1.0E-20
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 70 413 2.0E-20
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 70 413 2.0E-20
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 70 413 2.0E-20
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 70 413 2.0E-20
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 70 413 3.0E-20
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 70 412 3.0E-20
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 1838 2176 3.0E-20
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 1838 2176 3.0E-20
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 70 413 3.0E-20
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 31 415 4.0E-20
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 1838 2176 4.0E-20
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 1482 1728 8.0E-20
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 162 413 1.0E-19
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 1504 1796 1.0E-19
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 1799 2176 1.0E-19
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 1799 2176 1.0E-19
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 1799 2176 1.0E-19
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 1818 1994 1.0E-19
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 1818 1994 1.0E-19
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 1818 1994 1.0E-19
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 1482 1728 2.0E-19
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 12 410 2.0E-19
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 1505 1708 3.0E-19
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 1508 1801 3.0E-19
sp|P39525|CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEM1 PE=1 SV=1 89 413 3.0E-19
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 12 411 4.0E-19
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1837 2017 4.0E-19
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 84 407 7.0E-19
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 148 413 1.0E-18
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1824 2150 1.0E-18
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 1481 1799 2.0E-18
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 1489 1728 4.0E-18
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 28 407 7.0E-18
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 1503 1800 7.0E-18
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 12 406 1.0E-17
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 1482 1728 1.0E-17
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 1489 1728 2.0E-17
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 514 807 2.0E-17
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 12 413 2.0E-17
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 1482 1770 2.0E-17
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 1504 1799 2.0E-17
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 159 410 3.0E-17
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1825 1994 3.0E-17
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 12 407 4.0E-17
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1821 1993 4.0E-17
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 88 411 5.0E-17
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 12 411 7.0E-17
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 1482 1728 1.0E-16
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 26 411 1.0E-16
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 1508 1770 3.0E-16
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 513 820 3.0E-16
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 12 413 3.0E-16
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1805 2155 3.0E-16
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 1508 1801 8.0E-16
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1824 2138 1.0E-15
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 1494 1714 2.0E-15
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1802 2180 2.0E-15
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 1494 1714 7.0E-15
sp|Q7T3C7|RT4I1_DANRE Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Danio rerio GN=rtn4ip1 PE=2 SV=2 1485 1800 8.0E-15
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 159 411 1.0E-14
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 514 806 1.0E-14
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 88 413 2.0E-14
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 513 817 3.0E-14
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 513 817 3.0E-14
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 513 817 3.0E-14
sp|Q93QD4|FABD_STAAU Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1 513 817 4.0E-14
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 513 817 4.0E-14
sp|Q5HGK3|FABD_STAAC Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1 513 817 4.0E-14
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 1581 1801 4.0E-14
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 513 817 4.0E-14
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 175 413 5.0E-14
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 175 413 5.0E-14
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 175 413 5.0E-14
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1808 2178 9.0E-14
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 514 819 1.0E-13
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 109 413 1.0E-13
sp|Q02K94|FABB_PSEAB 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fabB PE=1 SV=1 109 413 1.0E-13
sp|Q9Z311|MECR_RAT Trans-2-enoyl-CoA reductase, mitochondrial OS=Rattus norvegicus GN=Mecr PE=1 SV=1 1474 1721 3.0E-13
sp|Q975C8|ACAR_SULTO Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 1507 1801 3.0E-13
sp|P0A953|FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) GN=fabB PE=1 SV=1 30 413 4.0E-13
sp|P0A954|FABB_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabB PE=3 SV=1 30 413 4.0E-13
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 176 406 4.0E-13
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 514 835 5.0E-13
sp|Q9DCS3|MECR_MOUSE Trans-2-enoyl-CoA reductase, mitochondrial OS=Mus musculus GN=Mecr PE=1 SV=2 1474 1724 7.0E-13
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1824 2042 7.0E-13
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 1499 1799 1.0E-12
sp|A4YGN2|ACAR_METS5 Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 1505 1799 2.0E-12
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 514 808 2.0E-12
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1821 2170 3.0E-12
sp|O74489|QOR_SCHPO Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 1501 1715 6.0E-12
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 12 414 1.0E-11
sp|Q8X8I7|FABD_ECO57 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O157:H7 GN=fabD PE=3 SV=3 513 814 2.0E-11
sp|P0C842|CJ052_HUMAN Putative uncharacterized protein encoded by LINC00614 OS=Homo sapiens GN=LINC00614 PE=5 SV=1 38 137 3.0E-11
sp|Q7YS70|MECR_BOVIN Trans-2-enoyl-CoA reductase, mitochondrial OS=Bos taurus GN=MECR PE=1 SV=1 1462 1714 4.0E-11
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1840 1980 4.0E-11
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 1499 1799 7.0E-11
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 514 806 7.0E-11
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 1508 1799 7.0E-11
sp|P0AAI9|FABD_ECOLI Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli (strain K12) GN=fabD PE=1 SV=2 513 814 8.0E-11
sp|P0AAJ0|FABD_ECOL6 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabD PE=3 SV=2 513 814 8.0E-11
sp|Q02062|KASB_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5088 PE=1 SV=1 12 382 1.0E-10
sp|Q9BV79|MECR_HUMAN Trans-2-enoyl-CoA reductase, mitochondrial OS=Homo sapiens GN=MECR PE=1 SV=2 1478 1656 1.0E-10
sp|Q8KA28|FABB_BUCAP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabB PE=3 SV=1 143 413 2.0E-10
sp|P9WQD9|FAB1_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasA PE=1 SV=1 169 413 2.0E-10
sp|P9WQD8|FAB1_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasA PE=3 SV=1 169 413 2.0E-10
sp|H8ESN0|FAB1_MYCTE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=kasA PE=2 SV=2 169 413 2.0E-10
sp|P63455|FAB1_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasA PE=3 SV=1 169 413 2.0E-10
sp|O94038|ADH2_CANAL Alcohol dehydrogenase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADH2 PE=3 SV=1 1565 1799 2.0E-10
sp|Q9CBS7|FAB1_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium leprae (strain TN) GN=kasA PE=3 SV=1 175 413 3.0E-10
sp|O85140|FABD_SALTY Malonyl CoA-acyl carrier protein transacylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabD PE=1 SV=3 513 814 4.0E-10
sp|Q8N4Q0|ZADH2_HUMAN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Homo sapiens GN=ZADH2 PE=1 SV=1 1492 1799 4.0E-10
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 159 411 6.0E-10
sp|P38230|QOR_YEAST Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 1489 1714 1.0E-09
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 12 411 1.0E-09
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 513 720 1.0E-09
sp|Q28GQ2|MECR_XENTR Trans-2-enoyl-CoA reductase, mitochondrial OS=Xenopus tropicalis GN=mecr PE=2 SV=1 1505 1678 1.0E-09
sp|Q3IZ91|CCR_RHOS4 Crotonyl-CoA reductase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ccr PE=3 SV=1 1488 1687 3.0E-09
sp|Q24K16|ZADH2_BOVIN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 1499 1714 4.0E-09
sp|Q6GQN8|MECR_DANRE Trans-2-enoyl-CoA reductase, mitochondrial OS=Danio rerio GN=mecr PE=2 SV=2 1487 1656 6.0E-09
sp|P43678|KAS1_STRRM Oxytetracycline polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces rimosus PE=3 SV=2 12 411 2.0E-08
sp|Q9C0Y6|YKM8_SCHPO Zinc-type alcohol dehydrogenase-like protein PB24D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.08c PE=3 SV=1 1544 1799 2.0E-08
sp|P43712|FABD_HAEIN Malonyl CoA-acyl carrier protein transacylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabD PE=3 SV=1 513 810 2.0E-08
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 1498 1714 2.0E-08
sp|Q8H0M1|QORH_SPIOL Quinone-oxidoreductase homolog, chloroplastic OS=Spinacia oleracea GN=QOR PE=1 SV=1 1486 1801 5.0E-08
sp|P49385|ADH4_KLULA Alcohol dehydrogenase 4, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH4 PE=3 SV=2 1565 1799 5.0E-08
sp|Q39173|P2_ARATH NADP-dependent alkenal double bond reductase P2 OS=Arabidopsis thaliana GN=P2 PE=2 SV=2 1599 1734 2.0E-07
sp|Q924D0|RT4I1_MOUSE Reticulon-4-interacting protein 1, mitochondrial OS=Mus musculus GN=Rtn4ip1 PE=1 SV=2 1485 1642 2.0E-07
sp|P40804|PKSF_BACSU Polyketide biosynthesis malonyl-ACP decarboxylase PksF OS=Bacillus subtilis (strain 168) GN=pksF PE=1 SV=3 124 410 2.0E-07
sp|P34055|INC11_HYPAT Protein indc11 OS=Hypocrea atroviridis GN=indc11 PE=2 SV=1 1493 1721 2.0E-07
sp|Q9V6U9|MECR_DROME Probable trans-2-enoyl-CoA reductase, mitochondrial OS=Drosophila melanogaster GN=CG16935 PE=3 SV=2 1476 1644 2.0E-07
sp|Q8K9J6|FABD_BUCAP Malonyl CoA-acyl carrier protein transacylase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabD PE=3 SV=1 515 737 7.0E-07
sp|P07246|ADH3_YEAST Alcohol dehydrogenase 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH3 PE=1 SV=2 1565 1799 7.0E-07
sp|P71534|FABG_MYCS2 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabG PE=3 SV=2 1825 1977 9.0E-07
sp|Q91YR9|PTGR1_MOUSE Prostaglandin reductase 1 OS=Mus musculus GN=Ptgr1 PE=1 SV=2 1579 1799 9.0E-07
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 1825 1974 9.0E-07
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 1825 1974 9.0E-07
sp|Q0VC50|RT4I1_BOVIN Reticulon-4-interacting protein 1, mitochondrial OS=Bos taurus GN=RTN4IP1 PE=2 SV=1 1485 1642 1.0E-06
sp|P97584|PTGR1_RAT Prostaglandin reductase 1 OS=Rattus norvegicus GN=Ptgr1 PE=2 SV=3 1580 1799 1.0E-06
sp|Q91VT4|CBR4_MOUSE Carbonyl reductase family member 4 OS=Mus musculus GN=Cbr4 PE=1 SV=2 1821 1972 1.0E-06
sp|Q8WWV3|RT4I1_HUMAN Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens GN=RTN4IP1 PE=1 SV=2 1485 1642 1.0E-06
sp|Q9SV68|QORH_ARATH Putative quinone-oxidoreductase homolog, chloroplastic OS=Arabidopsis thaliana GN=At4g13010 PE=2 SV=1 1507 1646 1.0E-06
sp|Q6WAU0|PULR_MENPI (+)-pulegone reductase OS=Mentha piperita PE=1 SV=1 1599 1733 1.0E-06
sp|Q9SLN8|DBR_TOBAC 2-alkenal reductase (NADP(+)-dependent) OS=Nicotiana tabacum GN=DBR PE=1 SV=1 1599 1733 1.0E-06
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 1825 1973 2.0E-06
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 1806 1974 2.0E-06
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 1820 1973 2.0E-06
sp|Q3SZJ4|PTGR1_BOVIN Prostaglandin reductase 1 OS=Bos taurus GN=PTGR1 PE=2 SV=1 1580 1799 2.0E-06
sp|O34812|YFMJ_BACSU Putative NADP-dependent oxidoreductase YfmJ OS=Bacillus subtilis (strain 168) GN=yfmJ PE=2 SV=1 1599 1710 3.0E-06
sp|P70720|FABG_AGGAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aggregatibacter actinomycetemcomitans GN=fabG PE=3 SV=1 1824 1973 3.0E-06
sp|Q39172|P1_ARATH NADP-dependent alkenal double bond reductase P1 OS=Arabidopsis thaliana GN=P1 PE=1 SV=1 1599 1734 4.0E-06
sp|Q29073|PTGR1_PIG Prostaglandin reductase 1 OS=Sus scrofa GN=PTGR1 PE=1 SV=1 1581 1799 5.0E-06
sp|P49384|ADH3_KLULA Alcohol dehydrogenase 3, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH3 PE=3 SV=2 1506 1799 6.0E-06
sp|Q9EQZ5|PTGR1_CAVPO Prostaglandin reductase 1 OS=Cavia porcellus GN=Ptgr1 PE=1 SV=1 1580 1799 8.0E-06
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 840 1099 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|476
MAHDEGSKPTPVSIIGMSCRLPGGVSTLDELWTMLSRGRTGWSEIPEDRFSSHAFYHPNPQKKGCFNTKYGYFLD
HDLTKFDAPFFNITQQEAKAMDPQQRLLLECAFEAVENAGLSREAIAGSNMGVFVGGARSDYYDGVARNLDEIPM
FAATGGHASVMSGRISHCLDLRGPCMTLDTACSSGLYALHAAAQSIRLRECDTALVAGCNLHFLPDSWVSMSMSR
AQSGFARGEGAACLLLKRLDLATRDNDRIQSIIVNTGTNQDGRTVGLSAPNGKAQEQLIRDVYERAGVSVHDVGF
VEAHGTGTKAGDPIEARALYNVFGEGRSKRQPLYIGSVKTNIGHLENVSGIVSVIKATMMLDRGFILPNVNFEKA
NESIPLDEWNIKANSFPPLLFVNNFGFGGSNAHCILERRPLSFEGALQKTSDGQHKLFVVSGHSEAAARQRGKDL
SIYAEQHPEVFQKCLVRDLAYTLGERRSHMQWRTAMTASCCKELVEQLNSAGANPSRVGKRPRVGFVFTGQGAQW
HAMGRELMTSHAVFAQTMREADACLGRLGADFSLLEELARDKEQSGVDEAHISQPACTALQLALVRLLASWGVEP
VAVTGHSSGEIAAAYAAGGLELEDALKVAYFRGQATRHIKTRYPELRGAMLAVGASAQQVGKIIKTQGITGATVA
CQNSPDSATVSGDAHAVEQVAAELERSSIFHRKLRVDVAYHSAHMELVAGDYQADIGSIRAKGEKGVAFYSSLLG
RRVESLATLDAEYWVGNLVKPVLFSSAVQALCDEVRPAVLVEIGPHAALQGPVKQILKTLGRSATETTPLPSLVR
NQDATTAMLQLAGKLYVLGQSLDFSQVNALEGRELPRLLDDLAPYPWTRERYWAEARESRQHRLKPFARHDLLGL
LVDSGNDSEHAWRNILRTDEIPWLRGHQMQSLATFPLAGYLCMVVEAAAQRAALRRLEHGVLVMREVQAVAPLLI
KDGQGYEMLLTMRRYAEGTRSYSNEWDEFTISSWAEERGWLEHCRGLLSARKKSSSSSVVVAASGQTEAAGRLQE
ATRCCSTSISVADFYADLAARGAEYDAPFQLADTLQGGGEYSMAEVGLPDTSKLMPLNYETPSILPTVFMDLLLH
STFVNLGAGRGAMPALYMPSAIKRLVFDKEVAIPADGKVRVVSQGRAEVGSLTPADFDIDAWAPSSSSARPLLSL
TGLKMSPIQDKGMEEVVARPLCFKVQWEALDEVRRGGCNGSKEETASGSKEATISDSRVNGSKEETSRVNGGNHH
VNGSRVNGSPPLVDSATPIVLVTQRSSSDALVAALIHRLGLATRSPISVSPLEALDATDKLCICLYELDAPLTAS
LDRATFANVQHMLLASSAIAWLSSNKSPETAMSLGLLRSLRSETQKAALVVEFDAQSRLDAAAQSALVMAALAQS
LQQRPDEPRDYEFCEQDGQLVVARMVEDAHMNQVVQRKTQPCAMYMQPFEQGSRRLSIAVGTHGALDSLYFADEA
ELPLAPDEVEIRVAATGMNFKDVVIAMGQVPSAYLGVECSGTVSRVGEDVKRLLPGMRVCAMSLGAYGTFARCKA
SSAVEIPASMALDVAASIPVVYCTAYYSLVDVARLEPGETLLVHAAAGGVGQAAIQLAHMLGAHVFATVGSPDKK
RFLMDRYGILEQNIFYSRDAAFGPAIRDATRGRGVDVVLNSLAGDLLRETWECLAPFGRFIEIGKRDITSNSRLD
MAQFEHNVSFSSVDMTLVAMERPSVMQRILGQVMGLIARGSLEPIGPLTVMGISEVEGALRMMQGGKSMGKIIIA
PRAGEQVKATHQPCADILSSDAAFLIIGGTGGIGRSMAYWMAQHGARHIVLLSRSGRATDETLQLTEQCRRLGAA
IYVWACDAADRAAVDRVVAECEQTLPPIRGIIHAAMVLRDVLFEQMTFADFDQVVQAKVSGARNFDLALCHSPLD
FFILLSSVAGIVGNRGQAAYAAANTYLDALVHHRRALGLPATTLRLTAVTDVGYLSAHARRRHQVLQNMSGSAMT
ESQVLALLEATLCGQVAAGECTTGLTADHDVFFAHDARFTYLCQAAAAAEAASSQGGRESISVQDEVCRAASYDE
ALSVVTLRLWEKLCAILMLQAQDLDAKSTVRSYGLDSLNAIELRNWIGKELSAHLQVLELLTTGTMRDLGVLVLK
KSKVALMSAEEGQSV*
Coding >OphauB2|476
ATGGCTCACGATGAAGGAAGCAAGCCTACGCCTGTTTCCATTATTGGCATGTCATGCCGGTTGCCCGGGGGCGTG
TCTACGCTGGATGAGCTTTGGACAATGCTATCCAGAGGGCGGACGGGGTGGAGCGAGATTCCCGAGGACAGGTTC
AGCAGCCATGCCTTTTACCATCCGAATCCTCAGAAAAAGGGCTGCTTTAATACCAAGTACGGATACTTTTTAGAC
CACGACTTGACCAAGTTTGACGCGCCCTTTTTCAACATAACGCAGCAAGAGGCCAAGGCCATGGATCCGCAGCAG
CGGTTACTGCTAGAATGTGCCTTTGAAGCCGTGGAAAACGCAGGCCTGTCCAGAGAAGCCATTGCCGGCAGCAAC
ATGGGCGTCTTTGTGGGCGGCGCGCGGTCCGACTACTACGACGGGGTGGCACGCAATCTAGACGAGATTCCCATG
TTTGCCGCCACGGGCGGACACGCGTCGGTAATGTCTGGCCGGATTTCGCATTGTCTGGATCTGCGCGGGCCGTGC
ATGACGCTGGACACGGCGTGCTCGTCGGGCCTGTATGCGCTTCACGCAGCAGCGCAGAGCATTCGTTTGCGCGAG
TGCGACACGGCCTTGGTGGCGGGCTGTAATTTGCATTTCCTGCCCGACAGCTGGGTTTCCATGTCCATGTCAAGG
GCGCAATCTGGCTTTGCTCGGGGCGAGGGGGCGGCGTGTCTGCTTCTCAAGCGTCTGGACCTGGCGACAAGAGAC
AATGATAGGATCCAGTCCATTATTGTGAATACGGGAACAAACCAAGACGGAAGGACTGTTGGCCTGTCGGCTCCC
AACGGCAAAGCTCAGGAACAGCTTATTCGAGACGTGTACGAGCGGGCAGGAGTGAGCGTGCATGATGTTGGCTTT
GTGGAGGCGCACGGCACGGGGACAAAGGCGGGCGACCCGATTGAGGCGCGAGCGCTATACAATGTGTTTGGCGAG
GGGCGGAGCAAGCGACAGCCGCTGTATATTGGCTCGGTCAAGACGAATATCGGACACTTGGAAAACGTCAGCGGC
ATCGTCTCGGTCATCAAGGCGACTATGATGCTGGACAGGGGCTTTATTCTGCCCAATGTCAATTTTGAAAAGGCC
AATGAGAGCATTCCCCTGGATGAGTGGAACATCAAGGCAAACTCTTTCCCCCCTCTTCTTTTCGTCAACAACTTT
GGCTTTGGCGGGTCCAACGCGCACTGCATCCTGGAGCGGCGCCCCCTCTCGTTTGAAGGCGCGCTGCAAAAGACG
AGCGACGGACAGCACAAGCTCTTTGTCGTTTCTGGGCACAGCGAAGCAGCGGCCCGGCAGCGCGGCAAAGACTTG
AGCATCTACGCGGAGCAGCACCCCGAGGTGTTTCAAAAGTGCCTGGTGCGCGACCTGGCCTACACGCTGGGCGAG
CGGCGCTCCCACATGCAGTGGCGCACAGCCATGACGGCGTCGTGCTGCAAGGAGCTGGTGGAGCAGCTCAACAGC
GCGGGCGCCAACCCAAGCCGCGTGGGCAAGCGGCCGAGAGTAGGCTTTGTCTTTACAGGCCAAGGGGCGCAGTGG
CATGCCATGGGGCGGGAGCTCATGACGTCGCATGCCGTGTTTGCGCAGACGATGCGAGAGGCGGATGCTTGTCTG
GGACGGCTGGGCGCTGACTTTTCCCTGCTGGAGGAGCTGGCGCGCGACAAGGAGCAGTCGGGAGTCGACGAGGCG
CATATTAGCCAGCCGGCGTGTACGGCGCTGCAGCTGGCTCTGGTGCGGCTGCTGGCTTCCTGGGGGGTAGAGCCG
GTGGCGGTGACGGGACACTCGAGCGGTGAGATTGCAGCGGCGTACGCAGCAGGCGGCCTTGAGCTCGAGGATGCC
CTAAAGGTGGCGTATTTCCGAGGCCAGGCTACGCGGCACATCAAGACGCGGTACCCTGAGCTGCGAGGCGCCATG
CTAGCAGTGGGAGCGAGCGCGCAACAAGTGGGCAAAATCATCAAGACGCAGGGCATAACGGGCGCAACAGTGGCG
TGTCAAAACTCGCCCGACTCGGCCACTGTTTCGGGCGACGCACATGCCGTGGAGCAGGTGGCTGCTGAGCTGGAG
CGGAGCAGCATTTTCCACCGAAAACTGCGCGTCGACGTGGCCTACCATTCTGCGCACATGGAGCTGGTGGCGGGC
GACTACCAAGCCGATATTGGCAGTATACGAGCAAAAGGGGAAAAGGGCGTCGCGTTTTACTCATCGCTGCTTGGT
CGGCGCGTCGAGTCCCTGGCTACTCTTGATGCCGAGTACTGGGTGGGAAATCTCGTCAAACCCGTCTTGTTTAGC
TCAGCCGTGCAAGCGCTCTGCGACGAGGTGCGGCCAGCCGTCTTGGTTGAGATTGGGCCACACGCCGCCCTCCAA
GGCCCCGTCAAGCAGATTCTCAAGACGCTGGGCCGCAGCGCCACCGAGACGACACCTCTGCCCAGCCTGGTGCGC
AACCAAGACGCCACCACGGCCATGCTGCAACTCGCCGGCAAGCTCTATGTGCTGGGCCAGAGCCTCGACTTTTCC
CAAGTCAATGCGCTCGAGGGCCGCGAGCTGCCCCGACTGCTCGACGACTTGGCGCCCTACCCCTGGACGCGGGAA
AGATACTGGGCCGAGGCGCGGGAGAGCCGGCAGCACCGCCTCAAGCCGTTTGCGCGGCACGACCTCTTGGGGCTG
CTCGTCGACTCGGGCAACGACTCGGAGCACGCGTGGCGCAATATCCTGCGCACTGATGAGATTCCCTGGCTGCGC
GGCCACCAGATGCAGTCGCTGGCTACGTTTCCCCTGGCTGGATACTTGTGCATGGTGGTGGAGGCGGCGGCGCAG
CGAGCGGCGTTGAGGAGGCTGGAGCATGGCGTGCTGGTGATGCGCGAGGTGCAGGCGGTGGCGCCGCTCCTCATC
AAGGATGGACAGGGCTATGAGATGCTGCTCACCATGCGGCGCTATGCAGAAGGCACGCGCTCCTACTCGAATGAA
TGGGACGAGTTTACCATTTCCTCCTGGGCCGAGGAGCGAGGCTGGCTGGAGCACTGTCGCGGCCTGCTGTCTGCG
CGGAAAAAGTCGTCGTCGTCGTCAGTGGTGGTGGCTGCGTCGGGCCAGACAGAGGCGGCGGGCAGGTTGCAAGAA
GCGACGCGGTGTTGCAGCACGAGTATTTCCGTGGCCGACTTTTACGCCGACTTGGCAGCACGCGGAGCCGAATAT
GACGCCCCCTTTCAACTAGCGGATACACTACAGGGCGGCGGCGAGTATAGCATGGCAGAGGTTGGCCTGCCCGAC
ACGTCCAAGCTGATGCCGTTAAACTACGAGACGCCATCGATTCTGCCCACCGTCTTTATGGATCTCTTGCTGCAT
TCCACCTTTGTCAATCTCGGGGCTGGGCGCGGCGCCATGCCGGCGCTGTACATGCCGTCGGCGATTAAGCGGCTC
GTCTTTGACAAGGAGGTGGCCATTCCGGCAGATGGCAAAGTGCGCGTCGTGTCGCAGGGCAGGGCCGAGGTGGGC
AGCCTGACGCCTGCGGATTTTGATATTGATGCGTGGGCGCCAAGCTCGAGCTCTGCGCGGCCGCTGCTGAGTCTG
ACGGGGTTGAAAATGTCGCCGATTCAGGACAAGGGCATGGAGGAGGTGGTGGCGCGGCCGCTGTGCTTCAAGGTG
CAGTGGGAGGCGCTCGACGAGGTGCGCCGAGGGGGCTGCAATGGCAGCAAAGAGGAGACGGCCAGTGGCAGCAAA
GAGGCGACCATCAGTGACAGCAGAGTAAATGGCAGCAAAGAAGAGACGAGCAGAGTAAATGGCGGAAACCACCAC
GTCAATGGCAGCAGAGTAAATGGCAGCCCCCCCCTCGTCGACTCTGCAACGCCCATTGTCCTCGTTACCCAGCGC
AGCTCCAGCGACGCCCTCGTGGCCGCCCTCATCCACCGTCTCGGCCTGGCCACCCGCTCCCCCATCTCCGTCTCT
CCCCTAGAAGCCCTCGACGCCACCGACAAGCTCTGCATCTGCCTCTACGAGCTCGACGCGCCCCTGACTGCTTCC
TTGGACCGCGCCACCTTTGCCAACGTGCAGCACATGCTCCTCGCCTCCTCGGCCATCGCCTGGCTAAGCAGCAAC
AAGAGTCCCGAAACAGCAATGTCGCTCGGCCTGCTGCGAAGTCTCCGCTCCGAGACGCAAAAGGCGGCCCTAGTC
GTCGAGTTCGATGCCCAGTCTCGCCTCGACGCCGCCGCCCAGTCCGCCCTGGTCATGGCAGCGCTGGCCCAGTCA
CTCCAGCAACGCCCCGACGAGCCTCGCGACTACGAGTTTTGCGAGCAAGACGGCCAACTAGTAGTGGCGCGCATG
GTGGAGGATGCGCACATGAATCAAGTGGTGCAGCGCAAGACACAGCCGTGCGCCATGTACATGCAGCCGTTTGAG
CAAGGCAGCCGCCGCTTGAGCATTGCAGTTGGCACCCATGGCGCGCTCGACTCGCTCTACTTTGCAGACGAGGCC
GAGCTGCCTCTGGCGCCGGACGAGGTGGAAATCCGCGTTGCGGCCACGGGCATGAATTTCAAAGACGTAGTCATT
GCCATGGGCCAGGTGCCGAGTGCATATCTCGGCGTCGAGTGCAGCGGCACCGTGTCTCGAGTAGGAGAGGACGTG
AAGCGCCTTTTGCCAGGAATGCGCGTCTGTGCAATGTCGCTGGGCGCATACGGCACCTTTGCGCGATGCAAGGCC
AGCAGCGCTGTTGAAATCCCCGCCAGCATGGCCCTCGACGTGGCTGCCTCTATCCCCGTCGTCTACTGCACCGCC
TACTATAGCCTGGTGGACGTGGCGCGCCTCGAGCCAGGCGAAACACTCCTGGTGCATGCCGCAGCGGGAGGCGTC
GGCCAGGCTGCCATTCAGCTGGCACACATGCTGGGCGCACACGTCTTTGCCACGGTGGGCAGCCCCGACAAGAAG
CGCTTCCTCATGGACCGCTACGGGATCCTCGAGCAGAATATTTTCTATAGCCGAGACGCGGCCTTTGGCCCAGCC
ATTCGCGACGCCACGCGTGGACGAGGCGTCGACGTTGTTTTGAATTCCCTGGCGGGCGACTTGCTGCGCGAAACG
TGGGAGTGTCTGGCGCCCTTTGGCCGCTTCATTGAGATTGGCAAGCGAGACATTACCAGCAACTCGCGCCTCGAC
ATGGCCCAGTTTGAACACAATGTCTCCTTTAGCTCCGTCGACATGACTCTGGTGGCCATGGAGCGCCCAAGCGTC
ATGCAGCGCATCCTGGGGCAAGTCATGGGCCTCATTGCCCGAGGCAGCCTTGAGCCCATTGGGCCTCTGACTGTC
ATGGGCATCTCCGAGGTGGAGGGCGCGCTGCGCATGATGCAGGGCGGCAAGTCGATGGGCAAAATCATCATTGCG
CCGCGTGCCGGAGAGCAAGTCAAGGCCACGCATCAGCCCTGTGCCGACATTCTCTCGTCAGACGCCGCATTTCTC
ATCATTGGAGGCACCGGCGGCATTGGTCGCTCCATGGCCTATTGGATGGCACAGCATGGCGCCCGACACATTGTC
CTCTTGTCGCGCAGCGGGCGCGCCACTGACGAGACGCTGCAACTCACCGAGCAGTGCCGACGCCTCGGTGCGGCC
ATTTACGTGTGGGCCTGCGACGCGGCAGACAGGGCGGCCGTGGACCGCGTCGTGGCCGAGTGCGAGCAGACTCTG
CCGCCCATTCGAGGCATAATACACGCCGCCATGGTGCTCCGAGACGTCCTCTTTGAACAAATGACCTTTGCCGAC
TTTGACCAAGTCGTCCAGGCCAAGGTTTCCGGCGCCCGCAACTTTGACCTCGCCCTCTGCCACTCCCCCCTCGAC
TTCTTCATCCTCTTGTCCTCAGTGGCCGGCATCGTCGGAAACAGAGGCCAGGCCGCCTACGCCGCCGCAAACACC
TATCTCGACGCCCTCGTCCACCACCGCCGCGCCCTCGGCCTGCCCGCCACCACCCTCCGCCTCACCGCCGTCACC
GACGTGGGCTACCTGAGCGCTCACGCCCGCCGCCGCCACCAAGTCTTGCAAAACATGTCTGGCAGCGCCATGACC
GAGTCCCAAGTCTTGGCGCTGCTCGAAGCCACCCTCTGCGGCCAAGTAGCCGCCGGCGAGTGCACCACGGGCCTG
ACTGCCGACCACGACGTCTTTTTTGCACATGACGCGCGCTTCACATACTTGTGCCAGGCTGCCGCTGCCGCAGAG
GCTGCCTCTAGCCAAGGCGGCCGCGAGAGCATTTCAGTGCAGGACGAGGTGTGCCGCGCAGCGTCGTATGACGAG
GCGCTGAGCGTAGTGACGCTGCGGCTGTGGGAAAAGCTGTGTGCTATTCTCATGCTGCAGGCGCAGGACCTAGAT
GCCAAGAGCACGGTGCGCTCATATGGCCTCGATTCACTCAATGCCATTGAGTTGAGGAATTGGATTGGCAAGGAA
CTCTCGGCCCATTTGCAGGTGTTGGAGCTGTTGACTACGGGCACCATGCGCGATTTGGGCGTCTTGGTGTTGAAG
AAGAGCAAGGTGGCCTTGATGTCTGCCGAGGAGGGGCAAAGCGTTTAG
Transcript >OphauB2|476
ATGGCTCACGATGAAGGAAGCAAGCCTACGCCTGTTTCCATTATTGGCATGTCATGCCGGTTGCCCGGGGGCGTG
TCTACGCTGGATGAGCTTTGGACAATGCTATCCAGAGGGCGGACGGGGTGGAGCGAGATTCCCGAGGACAGGTTC
AGCAGCCATGCCTTTTACCATCCGAATCCTCAGAAAAAGGGCTGCTTTAATACCAAGTACGGATACTTTTTAGAC
CACGACTTGACCAAGTTTGACGCGCCCTTTTTCAACATAACGCAGCAAGAGGCCAAGGCCATGGATCCGCAGCAG
CGGTTACTGCTAGAATGTGCCTTTGAAGCCGTGGAAAACGCAGGCCTGTCCAGAGAAGCCATTGCCGGCAGCAAC
ATGGGCGTCTTTGTGGGCGGCGCGCGGTCCGACTACTACGACGGGGTGGCACGCAATCTAGACGAGATTCCCATG
TTTGCCGCCACGGGCGGACACGCGTCGGTAATGTCTGGCCGGATTTCGCATTGTCTGGATCTGCGCGGGCCGTGC
ATGACGCTGGACACGGCGTGCTCGTCGGGCCTGTATGCGCTTCACGCAGCAGCGCAGAGCATTCGTTTGCGCGAG
TGCGACACGGCCTTGGTGGCGGGCTGTAATTTGCATTTCCTGCCCGACAGCTGGGTTTCCATGTCCATGTCAAGG
GCGCAATCTGGCTTTGCTCGGGGCGAGGGGGCGGCGTGTCTGCTTCTCAAGCGTCTGGACCTGGCGACAAGAGAC
AATGATAGGATCCAGTCCATTATTGTGAATACGGGAACAAACCAAGACGGAAGGACTGTTGGCCTGTCGGCTCCC
AACGGCAAAGCTCAGGAACAGCTTATTCGAGACGTGTACGAGCGGGCAGGAGTGAGCGTGCATGATGTTGGCTTT
GTGGAGGCGCACGGCACGGGGACAAAGGCGGGCGACCCGATTGAGGCGCGAGCGCTATACAATGTGTTTGGCGAG
GGGCGGAGCAAGCGACAGCCGCTGTATATTGGCTCGGTCAAGACGAATATCGGACACTTGGAAAACGTCAGCGGC
ATCGTCTCGGTCATCAAGGCGACTATGATGCTGGACAGGGGCTTTATTCTGCCCAATGTCAATTTTGAAAAGGCC
AATGAGAGCATTCCCCTGGATGAGTGGAACATCAAGGCAAACTCTTTCCCCCCTCTTCTTTTCGTCAACAACTTT
GGCTTTGGCGGGTCCAACGCGCACTGCATCCTGGAGCGGCGCCCCCTCTCGTTTGAAGGCGCGCTGCAAAAGACG
AGCGACGGACAGCACAAGCTCTTTGTCGTTTCTGGGCACAGCGAAGCAGCGGCCCGGCAGCGCGGCAAAGACTTG
AGCATCTACGCGGAGCAGCACCCCGAGGTGTTTCAAAAGTGCCTGGTGCGCGACCTGGCCTACACGCTGGGCGAG
CGGCGCTCCCACATGCAGTGGCGCACAGCCATGACGGCGTCGTGCTGCAAGGAGCTGGTGGAGCAGCTCAACAGC
GCGGGCGCCAACCCAAGCCGCGTGGGCAAGCGGCCGAGAGTAGGCTTTGTCTTTACAGGCCAAGGGGCGCAGTGG
CATGCCATGGGGCGGGAGCTCATGACGTCGCATGCCGTGTTTGCGCAGACGATGCGAGAGGCGGATGCTTGTCTG
GGACGGCTGGGCGCTGACTTTTCCCTGCTGGAGGAGCTGGCGCGCGACAAGGAGCAGTCGGGAGTCGACGAGGCG
CATATTAGCCAGCCGGCGTGTACGGCGCTGCAGCTGGCTCTGGTGCGGCTGCTGGCTTCCTGGGGGGTAGAGCCG
GTGGCGGTGACGGGACACTCGAGCGGTGAGATTGCAGCGGCGTACGCAGCAGGCGGCCTTGAGCTCGAGGATGCC
CTAAAGGTGGCGTATTTCCGAGGCCAGGCTACGCGGCACATCAAGACGCGGTACCCTGAGCTGCGAGGCGCCATG
CTAGCAGTGGGAGCGAGCGCGCAACAAGTGGGCAAAATCATCAAGACGCAGGGCATAACGGGCGCAACAGTGGCG
TGTCAAAACTCGCCCGACTCGGCCACTGTTTCGGGCGACGCACATGCCGTGGAGCAGGTGGCTGCTGAGCTGGAG
CGGAGCAGCATTTTCCACCGAAAACTGCGCGTCGACGTGGCCTACCATTCTGCGCACATGGAGCTGGTGGCGGGC
GACTACCAAGCCGATATTGGCAGTATACGAGCAAAAGGGGAAAAGGGCGTCGCGTTTTACTCATCGCTGCTTGGT
CGGCGCGTCGAGTCCCTGGCTACTCTTGATGCCGAGTACTGGGTGGGAAATCTCGTCAAACCCGTCTTGTTTAGC
TCAGCCGTGCAAGCGCTCTGCGACGAGGTGCGGCCAGCCGTCTTGGTTGAGATTGGGCCACACGCCGCCCTCCAA
GGCCCCGTCAAGCAGATTCTCAAGACGCTGGGCCGCAGCGCCACCGAGACGACACCTCTGCCCAGCCTGGTGCGC
AACCAAGACGCCACCACGGCCATGCTGCAACTCGCCGGCAAGCTCTATGTGCTGGGCCAGAGCCTCGACTTTTCC
CAAGTCAATGCGCTCGAGGGCCGCGAGCTGCCCCGACTGCTCGACGACTTGGCGCCCTACCCCTGGACGCGGGAA
AGATACTGGGCCGAGGCGCGGGAGAGCCGGCAGCACCGCCTCAAGCCGTTTGCGCGGCACGACCTCTTGGGGCTG
CTCGTCGACTCGGGCAACGACTCGGAGCACGCGTGGCGCAATATCCTGCGCACTGATGAGATTCCCTGGCTGCGC
GGCCACCAGATGCAGTCGCTGGCTACGTTTCCCCTGGCTGGATACTTGTGCATGGTGGTGGAGGCGGCGGCGCAG
CGAGCGGCGTTGAGGAGGCTGGAGCATGGCGTGCTGGTGATGCGCGAGGTGCAGGCGGTGGCGCCGCTCCTCATC
AAGGATGGACAGGGCTATGAGATGCTGCTCACCATGCGGCGCTATGCAGAAGGCACGCGCTCCTACTCGAATGAA
TGGGACGAGTTTACCATTTCCTCCTGGGCCGAGGAGCGAGGCTGGCTGGAGCACTGTCGCGGCCTGCTGTCTGCG
CGGAAAAAGTCGTCGTCGTCGTCAGTGGTGGTGGCTGCGTCGGGCCAGACAGAGGCGGCGGGCAGGTTGCAAGAA
GCGACGCGGTGTTGCAGCACGAGTATTTCCGTGGCCGACTTTTACGCCGACTTGGCAGCACGCGGAGCCGAATAT
GACGCCCCCTTTCAACTAGCGGATACACTACAGGGCGGCGGCGAGTATAGCATGGCAGAGGTTGGCCTGCCCGAC
ACGTCCAAGCTGATGCCGTTAAACTACGAGACGCCATCGATTCTGCCCACCGTCTTTATGGATCTCTTGCTGCAT
TCCACCTTTGTCAATCTCGGGGCTGGGCGCGGCGCCATGCCGGCGCTGTACATGCCGTCGGCGATTAAGCGGCTC
GTCTTTGACAAGGAGGTGGCCATTCCGGCAGATGGCAAAGTGCGCGTCGTGTCGCAGGGCAGGGCCGAGGTGGGC
AGCCTGACGCCTGCGGATTTTGATATTGATGCGTGGGCGCCAAGCTCGAGCTCTGCGCGGCCGCTGCTGAGTCTG
ACGGGGTTGAAAATGTCGCCGATTCAGGACAAGGGCATGGAGGAGGTGGTGGCGCGGCCGCTGTGCTTCAAGGTG
CAGTGGGAGGCGCTCGACGAGGTGCGCCGAGGGGGCTGCAATGGCAGCAAAGAGGAGACGGCCAGTGGCAGCAAA
GAGGCGACCATCAGTGACAGCAGAGTAAATGGCAGCAAAGAAGAGACGAGCAGAGTAAATGGCGGAAACCACCAC
GTCAATGGCAGCAGAGTAAATGGCAGCCCCCCCCTCGTCGACTCTGCAACGCCCATTGTCCTCGTTACCCAGCGC
AGCTCCAGCGACGCCCTCGTGGCCGCCCTCATCCACCGTCTCGGCCTGGCCACCCGCTCCCCCATCTCCGTCTCT
CCCCTAGAAGCCCTCGACGCCACCGACAAGCTCTGCATCTGCCTCTACGAGCTCGACGCGCCCCTGACTGCTTCC
TTGGACCGCGCCACCTTTGCCAACGTGCAGCACATGCTCCTCGCCTCCTCGGCCATCGCCTGGCTAAGCAGCAAC
AAGAGTCCCGAAACAGCAATGTCGCTCGGCCTGCTGCGAAGTCTCCGCTCCGAGACGCAAAAGGCGGCCCTAGTC
GTCGAGTTCGATGCCCAGTCTCGCCTCGACGCCGCCGCCCAGTCCGCCCTGGTCATGGCAGCGCTGGCCCAGTCA
CTCCAGCAACGCCCCGACGAGCCTCGCGACTACGAGTTTTGCGAGCAAGACGGCCAACTAGTAGTGGCGCGCATG
GTGGAGGATGCGCACATGAATCAAGTGGTGCAGCGCAAGACACAGCCGTGCGCCATGTACATGCAGCCGTTTGAG
CAAGGCAGCCGCCGCTTGAGCATTGCAGTTGGCACCCATGGCGCGCTCGACTCGCTCTACTTTGCAGACGAGGCC
GAGCTGCCTCTGGCGCCGGACGAGGTGGAAATCCGCGTTGCGGCCACGGGCATGAATTTCAAAGACGTAGTCATT
GCCATGGGCCAGGTGCCGAGTGCATATCTCGGCGTCGAGTGCAGCGGCACCGTGTCTCGAGTAGGAGAGGACGTG
AAGCGCCTTTTGCCAGGAATGCGCGTCTGTGCAATGTCGCTGGGCGCATACGGCACCTTTGCGCGATGCAAGGCC
AGCAGCGCTGTTGAAATCCCCGCCAGCATGGCCCTCGACGTGGCTGCCTCTATCCCCGTCGTCTACTGCACCGCC
TACTATAGCCTGGTGGACGTGGCGCGCCTCGAGCCAGGCGAAACACTCCTGGTGCATGCCGCAGCGGGAGGCGTC
GGCCAGGCTGCCATTCAGCTGGCACACATGCTGGGCGCACACGTCTTTGCCACGGTGGGCAGCCCCGACAAGAAG
CGCTTCCTCATGGACCGCTACGGGATCCTCGAGCAGAATATTTTCTATAGCCGAGACGCGGCCTTTGGCCCAGCC
ATTCGCGACGCCACGCGTGGACGAGGCGTCGACGTTGTTTTGAATTCCCTGGCGGGCGACTTGCTGCGCGAAACG
TGGGAGTGTCTGGCGCCCTTTGGCCGCTTCATTGAGATTGGCAAGCGAGACATTACCAGCAACTCGCGCCTCGAC
ATGGCCCAGTTTGAACACAATGTCTCCTTTAGCTCCGTCGACATGACTCTGGTGGCCATGGAGCGCCCAAGCGTC
ATGCAGCGCATCCTGGGGCAAGTCATGGGCCTCATTGCCCGAGGCAGCCTTGAGCCCATTGGGCCTCTGACTGTC
ATGGGCATCTCCGAGGTGGAGGGCGCGCTGCGCATGATGCAGGGCGGCAAGTCGATGGGCAAAATCATCATTGCG
CCGCGTGCCGGAGAGCAAGTCAAGGCCACGCATCAGCCCTGTGCCGACATTCTCTCGTCAGACGCCGCATTTCTC
ATCATTGGAGGCACCGGCGGCATTGGTCGCTCCATGGCCTATTGGATGGCACAGCATGGCGCCCGACACATTGTC
CTCTTGTCGCGCAGCGGGCGCGCCACTGACGAGACGCTGCAACTCACCGAGCAGTGCCGACGCCTCGGTGCGGCC
ATTTACGTGTGGGCCTGCGACGCGGCAGACAGGGCGGCCGTGGACCGCGTCGTGGCCGAGTGCGAGCAGACTCTG
CCGCCCATTCGAGGCATAATACACGCCGCCATGGTGCTCCGAGACGTCCTCTTTGAACAAATGACCTTTGCCGAC
TTTGACCAAGTCGTCCAGGCCAAGGTTTCCGGCGCCCGCAACTTTGACCTCGCCCTCTGCCACTCCCCCCTCGAC
TTCTTCATCCTCTTGTCCTCAGTGGCCGGCATCGTCGGAAACAGAGGCCAGGCCGCCTACGCCGCCGCAAACACC
TATCTCGACGCCCTCGTCCACCACCGCCGCGCCCTCGGCCTGCCCGCCACCACCCTCCGCCTCACCGCCGTCACC
GACGTGGGCTACCTGAGCGCTCACGCCCGCCGCCGCCACCAAGTCTTGCAAAACATGTCTGGCAGCGCCATGACC
GAGTCCCAAGTCTTGGCGCTGCTCGAAGCCACCCTCTGCGGCCAAGTAGCCGCCGGCGAGTGCACCACGGGCCTG
ACTGCCGACCACGACGTCTTTTTTGCACATGACGCGCGCTTCACATACTTGTGCCAGGCTGCCGCTGCCGCAGAG
GCTGCCTCTAGCCAAGGCGGCCGCGAGAGCATTTCAGTGCAGGACGAGGTGTGCCGCGCAGCGTCGTATGACGAG
GCGCTGAGCGTAGTGACGCTGCGGCTGTGGGAAAAGCTGTGTGCTATTCTCATGCTGCAGGCGCAGGACCTAGAT
GCCAAGAGCACGGTGCGCTCATATGGCCTCGATTCACTCAATGCCATTGAGTTGAGGAATTGGATTGGCAAGGAA
CTCTCGGCCCATTTGCAGGTGTTGGAGCTGTTGACTACGGGCACCATGCGCGATTTGGGCGTCTTGGTGTTGAAG
AAGAGCAAGGTGGCCTTGATGTCTGCCGAGGAGGGGCAAAGCGTTTAG
Gene >OphauB2|476
ATGGCTCACGATGAAGGAAGCAAGCCTACGCCTGTTTCCATTATTGGCATGTCATGCCGGTTGCCCGGGGGCGTG
TCTACGCTGGATGAGCTTTGGACAATGCTATCCAGAGGGCGGACGGGGTGGAGCGAGATTCCCGAGGACAGGTTC
AGCAGCCATGCCTTTTACCATCCGAATCCTCAGAAAAAGGGCTGCTTTAATACCAAGTACGGATACTTTTTAGAC
CACGACTTGACCAAGTTTGACGCGCCCTTTTTCAACATAACGCAGCAAGAGGCCAAGGCCATGGGTATGTTTGCT
TGCTTCCCATTGGGGGTGTGCAATAAACTAATAGACTTTTTTTTTGGTACTCTGCTAGATCCGCAGCAGCGGTTA
CTGCTAGAATGTGCCTTTGAAGCCGTGGAAAACGCAGGCCTGTCCAGAGAAGCCATTGCCGGCAGCAACATGGGC
GTCTTTGTGGGCGGCGCGCGGTCCGACTACTACGACGGGGTGGCACGCAATCTAGACGAGATTCCCATGTTTGCC
GCCACGGGCGGACACGCGTCGGTAATGTCTGGCCGGATTTCGCATTGTCTGGATCTGCGCGGGCCGTGCATGACG
CTGGACACGGCGTGCTCGTCGGGCCTGTATGCGCTTCACGCAGCAGCGCAGAGCATTCGTTTGCGCGAGTGCGAC
ACGGCCTTGGTGGCGGGCTGTAATTTGCATTTCCTGCCCGACAGCTGGGTTTCCATGTCCATGTCAAGGTGAGTT
CATTTTGGGGACACAGCGCCAAAGACGAGGCTAACGGGGAGACTTGTGGTGTATAGTCTGTTTTGCGAACACGGA
CAGACGTATGCTTTTGACCATAGGGCGCAATCTGGCTTTGCTCGGGGCGAGGGGGCGGCGTGTCTGCTTCTCAAG
CGTCTGGACCTGGCGACAAGAGACAATGATAGGATCCAGTCCATTATTGTGAATACGGGAACAAACCAAGACGGA
AGGACTGTTGGTAAGGCCTTTTTTCTTTTTTTCTTTTTTCTTTTTGCTGCTTTTACCTTGGTCTTATGCAAAGAC
TCCTTTTTTTTTCTTTTTTTTCTTCTTCTAACTGGTTTTGCGCGTCCCGGCGGAAACGGATGAGATTATAGGCCT
GTCGGCTCCCAACGGCAAAGCTCAGGAACAGCTTATTCGAGACGTGTACGAGCGGGCAGGAGTGAGCGTGCATGA
TGTTGGCTTTGTGGAGGCGCACGGCACGGGGACAAAGGCGGGCGACCCGATTGAGGCGCGAGCGCTATACAATGT
GTTTGGCGAGGGGCGGAGCAAGCGACAGCCGCTGTATATTGGCTCGGTCAAGACGAATATCGGACACTTGGAAAA
CGTCAGCGGCATCGTCTCGGTCATCAAGGCGACTATGATGCTGGACAGGGGCTTTATTCTGCCCAATGTCAATTT
TGAAAAGGCCAATGAGAGCATTCCCCTGGATGAGTGGAACATCAAGGCAAACTCTTTCCCCCCTCTTCTTTTGTG
ACTCCTTGTATCCCCCCAGACACAGCAGCTTTGTTCCCATGCTAACACGGGGTGCAACAAGGTTCCCACGACGCT
GCGATCATGGCCTCCTCAAAAACGGCTGCTCAGCGTCAACAACTTTGGCTTTGGCGGGTCCAACGCGCACTGCAT
CCTGGAGCGGCGCCCCCTCTCGTTTGAAGGCGCGCTGCAAAAGACGAGCGACGGACAGCACAAGCTCTTTGTCGT
TTCTGGGCACAGCGAAGCAGCGGCCCGGCAGCGCGGCAAAGACTTGAGCATCTACGCGGAGCAGCACCCCGAGGT
GTTTCAAAAGTGCCTGGTGCGCGACCTGGCCTACACGCTGGGCGAGCGGCGCTCCCACATGCAGTGGCGCACAGC
CATGACGGCGTCGTGCTGCAAGGAGCTGGTGGAGCAGCTCAACAGCGCGGGCGCCAACCCAAGCCGCGTGGGCAA
GCGGCCGAGAGTAGGCTTTGTCTTTACAGGCCAAGGGGCGCAGTGGCATGCCATGGGGCGGGAGCTCATGACGTC
GCATGCCGTGTTTGCGCAGACGATGCGAGAGGCGGATGCTTGTCTGGGACGGCTGGGCGCTGACTTTTCCCTGCT
GGAGGAGCTGGCGCGCGACAAGGAGCAGTCGGGAGTCGACGAGGCGCATATTAGCCAGCCGGCGTGTACGGCGCT
GCAGCTGGCTCTGGTGCGGCTGCTGGCTTCCTGGGGGGTAGAGCCGGTGGCGGTGACGGGACACTCGAGCGGTGA
GATTGCAGCGGCGTACGCAGCAGGCGGCCTTGAGCTCGAGGATGCCCTAAAGGTGGCGTATTTCCGAGGCCAGGC
TACGCGGCACATCAAGACGCGGTACCCTGAGCTGCGAGGCGCCATGCTAGCAGTGGGAGCGAGCGCGCAACAAGT
GGGCAAAATCATCAAGACGCAGGGCATAACGGGCGCAACAGTGGCGTGTCAAAACTCGCCCGACTCGGCCACTGT
TTCGGGCGACGCACATGCCGTGGAGCAGGTGGCTGCTGAGCTGGAGCGGAGCAGCATTTTCCACCGAAAACTGCG
CGTCGACGTGGCCTACCATTCTGCGCACATGGAGCTGGTGGCGGGCGACTACCAAGCCGATATTGGCAGTATACG
AGCAAAAGGGGAAAAGGGCGTCGCGTTTTACTCATCGCTGCTTGGTCGGCGCGTCGAGTCCCTGGCTACTCTTGA
TGCCGAGTACTGGGTGGGAAATCTCGTCAAACCCGTCTTGTTTAGCTCAGCCGTGCAAGCGCTCTGCGACGAGGT
GCGGCCAGCCGTCTTGGTTGAGATTGGGCCACACGCCGCCCTCCAAGGCCCCGTCAAGCAGATTCTCAAGACGCT
GGGCCGCAGCGCCACCGAGACGACACCTCTGCCCAGCCTGGTGCGCAACCAAGACGCCACCACGGCCATGCTGCA
ACTCGCCGGCAAGCTCTATGTGCTGGGCCAGAGCCTCGACTTTTCCCAAGTCAATGCGCTCGAGGGCCGCGAGCT
GCCCCGACTGCTCGACGACTTGGCGCCCTACCCCTGGACGCGGGAAAGATACTGGGCCGAGGCGCGGGAGAGCCG
GCAGCACCGCCTCAAGCCGTTTGCGCGGCACGACCTCTTGGGGCTGCTCGTCGACTCGGGCAACGACTCGGAGCA
CGCGTGGCGCAATATCCTGCGCACTGATGAGATTCCCTGGCTGCGCGGCCACCAGATGCAGTCGCTGGCTACGTT
TCCCCTGGCTGGATACTTGTGCATGGTGGTGGAGGCGGCGGCGCAGCGAGCGGCGTTGAGGAGGCTGGAGCATGG
CGTGCTGGTGATGCGCGAGGTGCAGGCGGTGGCGCCGCTCCTCATCAAGGATGGACAGGGCTATGAGATGCTGCT
CACCATGCGGCGCTATGCAGAAGGCACGCGCTCCTACTCGAATGAATGGGACGAGTTTACCATTTCCTCCTGGGC
CGAGGAGCGAGGCTGGCTGGAGCACTGTCGCGGCCTGCTGTCTGCGCGGAAAAAGTCGTCGTCGTCGTCAGTGGT
GGTGGCTGCGTCGGGCCAGACAGAGGCGGCGGGCAGGTTGCAAGAAGCGACGCGGTGTTGCAGCACGAGTATTTC
CGTGGCCGACTTTTACGCCGACTTGGCAGCACGCGGAGCCGAATATGACGCCCCCTTTCAACTAGCGGATACACT
ACAGGGCGGCGGCGAGTATAGCATGGCAGAGGTTGGCCTGCCCGACACGTCCAAGCTGATGCCGTTAAACTACGA
GACGCCATCGATTCTGCCCACCGTCTTTATGGATCTCTTGCTGCATTCCACCTTTGTCAATCTCGGGGCTGGGCG
CGGCGCCATGCCGGCGCTGTACATGCCGTCGGCGATTAAGCGGCTCGTCTTTGACAAGGAGGTGGCCATTCCGGC
AGATGGCAAAGTGCGCGTCGTGTCGCAGGGCAGGGCCGAGGTGGGCAGCCTGACGCCTGCGGATTTTGATATTGA
TGCGTGGGCGCCAAGCTCGAGCTCTGCGCGGCCGCTGCTGAGTCTGACGGGGTTGAAAATGTCGCCGATTCAGGA
CAAGGGCATGGAGGAGGTGGTGGCGCGGCCGCTGTGCTTCAAGGTGCAGTGGGAGGCGCTCGACGAGGTGCGCCG
AGGGGGCTGCAATGGCAGCAAAGAGGAGACGGCCAGTGGCAGCAAAGAGGCGACCATCAGTGACAGCAGAGTAAA
TGGCAGCAAAGAAGAGACGAGCAGAGTAAATGGCGGAAACCACCACGTCAATGGCAGCAGAGTAAATGGCAGCCC
CCCCCTCGTCGACTCTGCAACGCCCATTGTCCTCGTTACCCAGCGCAGCTCCAGCGACGCCCTCGTGGCCGCCCT
CATCCACCGTCTCGGCCTGGCCACCCGCTCCCCCATCTCCGTCTCTCCCCTAGAAGCCCTCGACGCCACCGACAA
GCTCTGCATCTGCCTCTACGAGCTCGACGCGCCCCTGACTGCTTCCTTGGACCGCGCCACCTTTGCCAACGTGCA
GCACATGCTCCTCGCCTCCTCGGCCATCGCCTGGCTAAGCAGCAACAAGAGTCCCGAAACAGCAATGTCGCTCGG
CCTGCTGCGAAGTCTCCGCTCCGAGACGCAAAAGGCGGCCCTAGTCGTCGAGTTCGATGCCCAGTCTCGCCTCGA
CGCCGCCGCCCAGTCCGCCCTGGTCATGGCAGCGCTGGCCCAGTCACTCCAGCAACGCCCCGACGAGCCTCGCGA
CTACGAGTTTTGCGAGCAAGACGGCCAACTAGTAGTGGCGCGCATGGTGGAGGATGCGCACATGAATCAAGTGGT
GCAGCGCAAGACACAGCCGTGCGCCATGTACATGCAGCCGTTTGAGCAAGGCAGCCGCCGCTTGAGCATTGCAGT
TGGCACCCATGGCGCGCTCGACTCGCTCTACTTTGCAGACGAGGCCGAGCTGCCTCTGGCGCCGGACGAGGTGGA
AATCCGCGTTGCGGCCACGGGCATGAATTTCAAAGACGTAGTCATTGCCATGGGCCAGGTGCCGAGTGCATATCT
CGGCGTCGAGTGCAGCGGCACCGTGTCTCGAGTAGGAGAGGACGTGAAGCGCCTTTTGCCAGGAATGCGCGTCTG
TGCAATGTCGCTGGGCGCATACGGCACCTTTGCGCGATGCAAGGCCAGCAGCGCTGTTGAAATCCCCGCCAGCAT
GGCCCTCGACGTGGCTGCCTCTATCCCCGTCGTCTACTGCACCGCCTACTATAGCCTGGTGGACGTGGCGCGCCT
CGAGCCAGGCGAAACACTCCTGGTGCATGCCGCAGCGGGAGGCGTCGGCCAGGCTGCCATTCAGCTGGCACACAT
GCTGGGCGCACACGTCTTTGCCACGGTGGGCAGCCCCGACAAGAAGCGCTTCCTCATGGACCGCTACGGGATCCT
CGAGCAGAATATTTTCTATAGCCGAGACGCGGCCTTTGGCCCAGCCATTCGCGACGCCACGCGTGGACGAGGCGT
CGACGTTGTTTTGAATTCCCTGGCGGGCGACTTGCTGCGCGAAACGTGGGAGTGTCTGGCGCCCTTTGGCCGCTT
CATTGAGATTGGCAAGCGAGACATTACCAGCAACTCGCGCCTCGACATGGCCCAGTTTGAACACAATGTCTCCTT
TAGCTCCGTCGACATGACTCTGGTGGCCATGGAGCGCCCAAGCGTCATGCAGCGCATCCTGGGGCAAGTCATGGG
CCTCATTGCCCGAGGCAGCCTTGAGCCCATTGGGCCTCTGACTGTCATGGGCATCTCCGAGGTGGAGGGCGCGCT
GCGCATGATGCAGGGCGGCAAGTCGATGGGCAAAATCATCATTGCGCCGCGTGCCGGAGAGCAAGTCAAGGTAGG
TCTCTTTTTCCCCTGAAAACGCCTCCTTTTTGACGCCTCCTTTTTTTACCCCTGAAAACGTATTTTTTTTTAACG
CGACTTGCAAATCTAGGCCACGCATCAGCCCTGTGCCGACATTCTCTCGTCAGACGCCGCATTTCTCATCATTGG
AGGCACCGGCGGCATTGGTCGCTCCATGGCCTATTGGATGGCACAGCATGGCGCCCGACACATTGTCCTCTTGTC
GCGCAGCGGGCGCGCCACTGACGAGACGCTGCAACTCACCGAGCAGTGCCGACGCCTCGGTGCGGCCATTTACGT
GTGGGCCTGCGACGCGGCAGACAGGGCGGCCGTGGACCGCGTCGTGGCCGAGTGCGAGCAGACTCTGCCGCCCAT
TCGAGGCATAATACACGCCGCCATGGTGCTCCGAGTAAGCCAAAGCCTCTCCATACACCCAAACCTCTTCCTCCA
GCCAAACCTCTCCCTCTTTCAAAACACTCTTGAAAAAAACAAAAGACTAACACCTCTAGGACGTCCTCTTTGAAC
AAATGACCTTTGCCGACTTTGACCAAGTCGTCCAGGCCAAGGTTTCCGGCGCCCGCAACTTTGACCTCGCCCTCT
GCCACTCCCCCCTCGACTTCTTCATCCTCTTGTCCTCAGTGGCCGGCATCGTCGGAAACAGAGGCCAGGCCGCCT
ACGCCGCCGCAAACACCTATCTCGACGCCCTCGTCCACCACCGCCGCGCCCTCGGCCTGCCCGCCACCACCCTCC
GCCTCACCGCCGTCACCGACGTGGGCTACCTGAGCGCTCACGCCCGCCGCCGCCACCAAGTCTTGCAAAACATGT
CTGGCAGCGCCATGACCGAGTCCCAAGTCTTGGCGCTGCTCGAAGCCACCCTCTGCGGCCAAGTAGCCGCCGGCG
AGTGCACCACGGGCCTGACTGCCGACCACGACGTCTTTTTTGCACATGACGCGCGCTTCACATACTTGTGCCAGG
CTGCCGCTGCCGCAGAGGCTGCCTCTAGCCAAGGCGGCCGCGAGAGCATTTCAGTGCAGGACGAGGTGTGCCGCG
CAGCGTCGTATGACGAGGCGCTGAGCGTAGTGACGCTGCGGCTGTGGGAAAAGCTGTGTGCTATTCTCATGCTGC
AGGCGCAGGACCTAGATGCCAAGAGCACGGTGCGCTCATATGGCCTCGATTCACTCAATGCCATTGAGTTGAGGA
ATTGGATTGGCAAGGAACTCTCGGCCCATTTGCAGGTGTTGGAGCTGTTGACTACGGGCACCATGCGCGATTTGG
GCGTCTTGGTGTTGAAGAAGAGCAAGGTGGCCTTGATGTCTGCCGAGGAGGGGCAAAGCGTTTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail