Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4757
Gene name
LocationContig_33:20040..22067
Strand+
Gene length (bp)2027
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 7.5E-29 15 340
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 5.1E-06 17 47

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02N79|PQSH_PSEAB 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pqsH PE=1 SV=1 13 337 3.0E-20
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 13 337 1.0E-19
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 13 326 2.0E-14
sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 13 348 2.0E-14
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 16 330 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02N79|PQSH_PSEAB 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pqsH PE=1 SV=1 13 337 3.0E-20
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 13 337 1.0E-19
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 13 326 2.0E-14
sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 13 348 2.0E-14
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 16 330 1.0E-10
sp|O06489|YETM_BACSU Putative oxidoreductase YetM OS=Bacillus subtilis (strain 168) GN=yetM PE=3 SV=1 30 338 4.0E-10
sp|B5B0J6|HPXO_KLEOX FAD-dependent urate hydroxylase OS=Klebsiella oxytoca GN=hpxO PE=3 SV=1 13 328 2.0E-09
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 35 330 5.0E-09
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 50 330 2.0E-06
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 28 345 3.0E-06
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 33 330 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 13 31 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4757
MEKEAGLEKPPRLRAIIVGAGITGLVAAHAFERAGIDYVLLEKHKQLTPQLGGGIALCPGTLRLLSQLGMLERVH
KLGMPICPQAQLYNDEGEEKMKAPEMQLYKEWLGSEFWFIRRTDLLRELHECLEHGERVMLGKEVRRVQQSGCGA
RVECGDGTVQEGDFVLGTDGTHSIVREAIWEQVGRHDASRDAAAIKTNWRAAVGSRPTPRGRNNYTFVAVPDNGL
AVLGIQEPETFVFALWPADREGVGRQGEEVGEVVGRSRLGGGSVKEFLGGEYPSAKGFEVGEGVLGRWYGGRCMV
VGDAAHKIHPCLGVGASVCIADAIHLANNLAHAAHTLASPLTLAELEAVFAHTQAQALPPSRIYLFLAATQARLL
HRSGLLWRLLWHWPLLDLFESLVVHFTALATRQLPLLDYVPEGPWPEGRSEWRYGGKRKRGRSLDGVLTSVLLAV
LNMAARLWEMVH*
Coding >OphauB2|4757
ATGGAAAAAGAAGCCGGTTTGGAAAAGCCTCCTCGGCTTCGCGCCATCATTGTAGGAGCAGGAATCACAGGCCTA
GTAGCTGCGCACGCCTTTGAACGGGCCGGCATTGACTACGTGCTACTCGAAAAGCACAAACAGCTCACGCCGCAG
CTCGGCGGAGGAATTGCGCTGTGTCCCGGCACGTTGCGCCTCTTGAGCCAGCTAGGTATGCTGGAGCGAGTACAC
AAGCTAGGCATGCCGATTTGTCCACAGGCTCAACTCTACAATGACGAAGGAGAAGAAAAGATGAAGGCGCCCGAG
ATGCAACTATATAAAGAATGGCTGGGCAGCGAGTTTTGGTTCATTCGGCGGACAGACTTGCTGCGGGAGCTACAT
GAATGCCTGGAGCACGGGGAGCGCGTCATGCTGGGCAAGGAGGTGCGGCGGGTGCAGCAGAGCGGGTGTGGTGCG
CGGGTGGAGTGCGGCGACGGGACGGTGCAAGAGGGTGATTTTGTGCTGGGCACGGATGGGACGCATAGTATAGTG
CGCGAGGCGATTTGGGAGCAAGTCGGCCGCCACGACGCCTCGAGAGACGCAGCCGCAATAAAAACAAACTGGCGA
GCAGCAGTAGGTAGCAGGCCCACGCCGCGCGGGCGCAACAACTACACCTTTGTCGCGGTACCGGATAACGGACTC
GCAGTGCTGGGCATACAGGAACCAGAGACGTTTGTCTTTGCGCTGTGGCCGGCGGATAGGGAGGGGGTGGGGAGG
CAAGGAGAAGAGGTGGGCGAGGTGGTTGGTAGGAGTCGGTTGGGAGGGGGATCGGTAAAGGAGTTTTTGGGGGGG
GAGTATCCCTCGGCAAAGGGGTTTGAGGTGGGAGAGGGAGTGTTGGGGCGGTGGTATGGGGGGAGGTGCATGGTG
GTGGGTGATGCGGCGCACAAGATCCACCCCTGTCTCGGCGTCGGCGCCTCAGTCTGCATCGCCGACGCCATCCAC
CTGGCCAACAACCTCGCCCACGCCGCCCACACCCTCGCCTCGCCCCTCACCCTCGCCGAGCTCGAGGCCGTCTTT
GCACACACACAGGCCCAGGCCCTGCCCCCAAGCCGCATCTACCTCTTCCTCGCCGCCACGCAGGCGCGCCTCCTA
CACCGCAGCGGCCTGCTGTGGCGCCTGCTCTGGCACTGGCCGTTGCTCGACTTGTTTGAGTCGTTGGTGGTGCAC
TTTACCGCGCTGGCTACGAGGCAGCTTCCCCTGCTGGATTATGTGCCCGAGGGTCCGTGGCCAGAGGGACGGTCC
GAGTGGAGGTATGGAGGGAAAAGGAAGAGGGGCAGAAGCCTTGATGGGGTCTTGACAAGTGTGCTCTTGGCGGTT
TTGAACATGGCGGCGAGGCTGTGGGAGATGGTTCATTAA
Transcript >OphauB2|4757
ATGGAAAAAGAAGCCGGTTTGGAAAAGCCTCCTCGGCTTCGCGCCATCATTGTAGGAGCAGGAATCACAGGCCTA
GTAGCTGCGCACGCCTTTGAACGGGCCGGCATTGACTACGTGCTACTCGAAAAGCACAAACAGCTCACGCCGCAG
CTCGGCGGAGGAATTGCGCTGTGTCCCGGCACGTTGCGCCTCTTGAGCCAGCTAGGTATGCTGGAGCGAGTACAC
AAGCTAGGCATGCCGATTTGTCCACAGGCTCAACTCTACAATGACGAAGGAGAAGAAAAGATGAAGGCGCCCGAG
ATGCAACTATATAAAGAATGGCTGGGCAGCGAGTTTTGGTTCATTCGGCGGACAGACTTGCTGCGGGAGCTACAT
GAATGCCTGGAGCACGGGGAGCGCGTCATGCTGGGCAAGGAGGTGCGGCGGGTGCAGCAGAGCGGGTGTGGTGCG
CGGGTGGAGTGCGGCGACGGGACGGTGCAAGAGGGTGATTTTGTGCTGGGCACGGATGGGACGCATAGTATAGTG
CGCGAGGCGATTTGGGAGCAAGTCGGCCGCCACGACGCCTCGAGAGACGCAGCCGCAATAAAAACAAACTGGCGA
GCAGCAGTAGGTAGCAGGCCCACGCCGCGCGGGCGCAACAACTACACCTTTGTCGCGGTACCGGATAACGGACTC
GCAGTGCTGGGCATACAGGAACCAGAGACGTTTGTCTTTGCGCTGTGGCCGGCGGATAGGGAGGGGGTGGGGAGG
CAAGGAGAAGAGGTGGGCGAGGTGGTTGGTAGGAGTCGGTTGGGAGGGGGATCGGTAAAGGAGTTTTTGGGGGGG
GAGTATCCCTCGGCAAAGGGGTTTGAGGTGGGAGAGGGAGTGTTGGGGCGGTGGTATGGGGGGAGGTGCATGGTG
GTGGGTGATGCGGCGCACAAGATCCACCCCTGTCTCGGCGTCGGCGCCTCAGTCTGCATCGCCGACGCCATCCAC
CTGGCCAACAACCTCGCCCACGCCGCCCACACCCTCGCCTCGCCCCTCACCCTCGCCGAGCTCGAGGCCGTCTTT
GCACACACACAGGCCCAGGCCCTGCCCCCAAGCCGCATCTACCTCTTCCTCGCCGCCACGCAGGCGCGCCTCCTA
CACCGCAGCGGCCTGCTGTGGCGCCTGCTCTGGCACTGGCCGTTGCTCGACTTGTTTGAGTCGTTGGTGGTGCAC
TTTACCGCGCTGGCTACGAGGCAGCTTCCCCTGCTGGATTATGTGCCCGAGGGTCCGTGGCCAGAGGGACGGTCC
GAGTGGAGGTATGGAGGGAAAAGGAAGAGGGGCAGAAGCCTTGATGGGGTCTTGACAAGTGTGCTCTTGGCGGTT
TTGAACATGGCGGCGAGGCTGTGGGAGATGGTTCATTAA
Gene >OphauB2|4757
ATGGAAAAAGAAGCCGGTTTGGAAAAGCCTCCTCGGCTTCGCGCCATCATTGTAGGAGCAGGAATCACAGGCCTA
GTAGCTGCGCACGCCTTTGAACGGGCCGGCATTGACTACGTGCTACTCGAAAAGCACAAACAGCTCACGCCGCAG
CTCGGCGGAGGAATTGCGCTGTGTCCCGGCACGTTGCGCCTCTTGAGCCAGCTAGGTATGCTGGAGCGAGTACAC
AAGCTAGGCATGCCGATTTGTCCACAGGCTCAACTCTACAATGACGAAGGAGAAGAAAAGATGAAGGCGCCCGAG
ATGCAACTATATAAAGAATGGTGAGTTTTAAAGACGGGAAATTATTCATAATAATTTCAGAAAAGAAGAAAAGGA
CGAGGAGCTGATGCAAGAGAGAGAGAGAGAGGGAGAAACAGGCTGGGCAGCGAGTTTTGGTTCATTCGGCGGACA
GACTTGCTGCGGGAGCTACATGAATGCCTGGAGCACGGGGAGCGCGTCATGCTGGGCAAGGAGGTGCGGCGGGTG
CAGCAGAGCGGGTGTGGTGCGCGGGTGGAGTGCGGCGACGGGACGGTGCAAGAGGGTGATTTTGTGCTGGGCACG
GATGGGACGCATAGTATAGTGCGCGAGGCGATTTGGGAGCAAGTCGGCCGCCACGACGCCTCGAGAGACGCAGCC
GGTACCAATTCCTCCCCCCCTTTTTTTAAAAAATAAAAAAAAGAAGCGTGAAAAAGACTAACAAAAGGCTAGCAA
TAAAAACAAACTGGCGAGCAGCAGTAGGTAGCAGGCCCACGCCGCGCGGGCGCAACAACTACACCTTTGTCGCGG
TACCGGATAACGGACTCGCAGTGCTGGGCATACAGGAACCAGAGACGTTTGTCTTTGCGCTGTGGCCGGCGGATA
GGGAGGGGGTGGGGAGGCAAGGAGAAGAGGTGGGCGAGGTGGTTGGTAGGAGTCGGTTGGGAGGGGGATCGGTAA
AGGAGTTTTTGGGGGGGGAGTATCCCTCGGCAAAGGGGTTTGAGGTGGGAGAGGGAGTGTTGGGGCGGTGGTATG
GGGGGAGGTGCATGGTGGTGGGTGATGCGGCGCACAAGGTGAGTTGTTTTTTTTTTCCTTTTTTCTCTGTCGTCT
GCGTCCCTTTTTCTCTTGGAATATATGTTTTATTCTTTATCCTTTCCTCTTGGACTAGATGTTTTATTCTTTATC
CTTCTTTTCTTTGCTCTCTGTCGTCTGCGTCCCTTTTCCTCTTGAACTAGGTTTTTCCTTCTTTATCCTTCTTTT
CTTTACTCTCTGTCGTCTGCCTGCCTTTTCCTCTTGGATTAGATGTTTCCTTCTTTATCCCTCTCCTCTTGTACT
AGATGTTTTATTCTTTATCCTTCTTTTCTTTACTCTCTGTCGTCTGCCTGCCTTTTCCTCTTGGACTAGACGTTT
TATTCTTTATTCTTGTTTTATTCTATATCCTTCTTTTCTTTACTCTCTGTCGTCTGCCTGCCTTTTTCTCTTGGA
CTAGAAATCTCCCTCTTCATCCCTCTCCTCATATCGCCAATTCCAACCTCCTTTTCCAGATCCACCCCTGTCTCG
GCGTCGGCGCCTCAGTCTGCATCGCCGACGCCATCCACCTGGCCAACAACCTCGCCCACGCCGCCCACACCCTCG
CCTCGCCCCTCACCCTCGCCGAGCTCGAGGCCGTCTTTGCACACACACAGGCCCAGGCCCTGCCCCCAAGCCGCA
TCTACCTCTTCCTCGCCGCCACGCAGGCGCGCCTCCTACACCGCAGCGGCCTGCTGTGGCGCCTGCTCTGGCACT
GGCCGTTGCTCGACTTGTTTGAGTCGTTGGTGGTGCACTTTACCGCGCTGGCTACGAGGCAGCTTCCCCTGCTGG
ATTATGTGCCCGAGGGTCCGTGGCCAGAGGGACGGTCCGAGTGGAGGTATGGAGGGAAAAGGAAGAGGGGCAGAA
GCCTTGATGGGGTCTTGACAAGTGTGCTCTTGGCGGTTTTGAACATGGCGGCGAGGCTGTGGGAGATGGTTCATT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail