Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4755
Gene name
LocationContig_33:15788..16622
Strand-
Gene length (bp)834
Transcript length (bp)834
Coding sequence length (bp)834
Protein length (aa) 278

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 2.0E-13 44 147
PF08241 Methyltransf_11 Methyltransferase domain 6.0E-11 45 150
PF13847 Methyltransf_31 Methyltransferase domain 8.1E-10 41 151
PF08242 Methyltransf_12 Methyltransferase domain 1.0E-08 45 149
PF13489 Methyltransf_23 Methyltransferase domain 2.5E-07 36 153
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 6.1E-05 39 86
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 2.8E-04 35 101

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q67LE6|MENG_SYMTH Demethylmenaquinone methyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=menG PE=3 SV=1 7 150 4.0E-08

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4755
MVGASEYDQIGSAYNVIETLPYRSMEIRNVEMAIQPFLQPGMLVLDMACGTGSYTARLLSLGAGRVTGVDISSVM
IEEAKTRLAASLDAGLVRLCVGDGGMPQSWAPNGTENYFDLVFGGWFLNYASSRAELASFFKTIAINLAPNGVFV
GIIFPLVDNNDEMQRRAVAYNLQPLCRLRPHLDYTTPRPSGDGWNVRVNLGDSVSFSAWHLYRHVFEEAARDGGM
LGAFEWRHESLLEMDPWAKYYGLSLHEFKMRQQMPHMCTVVVRKEAAITANI*
Coding >OphauB2|4755
ATGGTCGGAGCTTCAGAGTATGACCAGATTGGAAGCGCATACAATGTCATAGAGACTTTACCCTATCGATCCATG
GAAATCCGAAACGTGGAAATGGCTATACAGCCATTTTTACAACCGGGAATGCTTGTCCTCGACATGGCGTGCGGC
ACTGGCTCCTACACTGCCCGATTGCTCAGCCTCGGTGCTGGCCGCGTGACGGGCGTAGATATATCCAGTGTCATG
ATAGAGGAGGCCAAGACTCGACTTGCTGCAAGTCTTGACGCTGGACTTGTCCGTCTCTGTGTTGGAGATGGTGGC
ATGCCACAATCGTGGGCGCCAAATGGCACGGAAAACTACTTTGACCTAGTCTTTGGAGGATGGTTCCTCAACTAC
GCCAGCTCCCGCGCCGAGCTCGCCTCCTTTTTCAAAACCATTGCCATCAATCTAGCTCCCAATGGAGTCTTTGTC
GGCATCATATTTCCTCTTGTGGACAACAACGATGAGATGCAGCGTAGGGCAGTGGCTTATAACCTCCAGCCATTG
TGCCGCCTGAGACCTCATCTTGACTACACGACACCACGGCCCTCTGGAGATGGTTGGAATGTGCGCGTCAACCTC
GGCGATAGCGTGAGCTTCTCGGCTTGGCACCTCTATCGCCACGTCTTTGAAGAGGCGGCTCGAGATGGTGGTATG
CTAGGAGCCTTTGAGTGGCGGCATGAGAGTCTCTTGGAAATGGATCCATGGGCCAAGTATTACGGACTGAGCTTG
CATGAGTTCAAGATGCGTCAACAAATGCCACACATGTGTACTGTTGTGGTTCGAAAAGAGGCCGCCATCACGGCT
AATATTTGA
Transcript >OphauB2|4755
ATGGTCGGAGCTTCAGAGTATGACCAGATTGGAAGCGCATACAATGTCATAGAGACTTTACCCTATCGATCCATG
GAAATCCGAAACGTGGAAATGGCTATACAGCCATTTTTACAACCGGGAATGCTTGTCCTCGACATGGCGTGCGGC
ACTGGCTCCTACACTGCCCGATTGCTCAGCCTCGGTGCTGGCCGCGTGACGGGCGTAGATATATCCAGTGTCATG
ATAGAGGAGGCCAAGACTCGACTTGCTGCAAGTCTTGACGCTGGACTTGTCCGTCTCTGTGTTGGAGATGGTGGC
ATGCCACAATCGTGGGCGCCAAATGGCACGGAAAACTACTTTGACCTAGTCTTTGGAGGATGGTTCCTCAACTAC
GCCAGCTCCCGCGCCGAGCTCGCCTCCTTTTTCAAAACCATTGCCATCAATCTAGCTCCCAATGGAGTCTTTGTC
GGCATCATATTTCCTCTTGTGGACAACAACGATGAGATGCAGCGTAGGGCAGTGGCTTATAACCTCCAGCCATTG
TGCCGCCTGAGACCTCATCTTGACTACACGACACCACGGCCCTCTGGAGATGGTTGGAATGTGCGCGTCAACCTC
GGCGATAGCGTGAGCTTCTCGGCTTGGCACCTCTATCGCCACGTCTTTGAAGAGGCGGCTCGAGATGGTGGTATG
CTAGGAGCCTTTGAGTGGCGGCATGAGAGTCTCTTGGAAATGGATCCATGGGCCAAGTATTACGGACTGAGCTTG
CATGAGTTCAAGATGCGTCAACAAATGCCACACATGTGTACTGTTGTGGTTCGAAAAGAGGCCGCCATCACGGCT
AATATTTGA
Gene >OphauB2|4755
ATGGTCGGAGCTTCAGAGTATGACCAGATTGGAAGCGCATACAATGTCATAGAGACTTTACCCTATCGATCCATG
GAAATCCGAAACGTGGAAATGGCTATACAGCCATTTTTACAACCGGGAATGCTTGTCCTCGACATGGCGTGCGGC
ACTGGCTCCTACACTGCCCGATTGCTCAGCCTCGGTGCTGGCCGCGTGACGGGCGTAGATATATCCAGTGTCATG
ATAGAGGAGGCCAAGACTCGACTTGCTGCAAGTCTTGACGCTGGACTTGTCCGTCTCTGTGTTGGAGATGGTGGC
ATGCCACAATCGTGGGCGCCAAATGGCACGGAAAACTACTTTGACCTAGTCTTTGGAGGATGGTTCCTCAACTAC
GCCAGCTCCCGCGCCGAGCTCGCCTCCTTTTTCAAAACCATTGCCATCAATCTAGCTCCCAATGGAGTCTTTGTC
GGCATCATATTTCCTCTTGTGGACAACAACGATGAGATGCAGCGTAGGGCAGTGGCTTATAACCTCCAGCCATTG
TGCCGCCTGAGACCTCATCTTGACTACACGACACCACGGCCCTCTGGAGATGGTTGGAATGTGCGCGTCAACCTC
GGCGATAGCGTGAGCTTCTCGGCTTGGCACCTCTATCGCCACGTCTTTGAAGAGGCGGCTCGAGATGGTGGTATG
CTAGGAGCCTTTGAGTGGCGGCATGAGAGTCTCTTGGAAATGGATCCATGGGCCAAGTATTACGGACTGAGCTTG
CATGAGTTCAAGATGCGTCAACAAATGCCACACATGTGTACTGTTGTGGTTCGAAAAGAGGCCGCCATCACGGCT
AATATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail