Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4753
Gene name
LocationContig_33:11416..12793
Strand-
Gene length (bp)1377
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 6.2E-05 5 58
PF01494 FAD_binding_3 FAD binding domain 6.4E-07 354 384
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 5.0E-05 7 37

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4857
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4753 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02422
Ophiocordyceps camponoti-rufipedis Ophun1|6768
Ophiocordyceps kimflemingae Ophio5|2813
Ophiocordyceps subramaniannii Hirsu2|10975

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4753
MPPRIAIVGGGPAGLCLAALLHHRGIPLTLYELRQRPPASAVSTPCSMLDLHHETGLAAVRACGLWERLAPLTTA
CAESTIIRRPNGSVTYHDGGNASYRPEVSRAALVDLLLWATAEGSIRWGSKVCGVRQRGDGTVALQVSRGEGGEA
DESQSSSSRDEEGWSRDDERRSSRDEEQWSRDKRRKSSKDETEYDVVIGADGAWSRVRSLVTPVKPHYGGVCYTT
LRIAQAEQRYPHLSALVGPGTCCILGNERVLSSHRSIAGSIVLHASTASATEASICDASRGLSTAQMEELMLHDA
RFFGGWGCPLVRQLLATAIASQAQLPPFEPPVFKPMYMLPVGHAWPANQASATLIGDAAHLMMPWAGEGVNLALR
DALDLADALDGAWGETRGGQQDGGLFREALRPRLARFEEAMFARAAQAAHETWQNSGIFFGRDSARRLGDLMAGF
TAQGQGER*
Coding >OphauB2|4753
ATGCCGCCACGCATTGCCATTGTGGGCGGTGGTCCTGCAGGCCTCTGTCTCGCCGCCCTGTTGCATCACCGCGGC
ATCCCCCTGACTCTGTATGAGCTGCGCCAGCGGCCGCCAGCGTCTGCCGTTTCGACGCCCTGCAGCATGCTCGAC
TTGCATCACGAGACGGGCCTAGCTGCTGTGCGCGCCTGTGGTCTGTGGGAGCGTCTTGCTCCACTCACCACGGCT
TGCGCCGAGAGCACCATTATCAGACGGCCCAATGGCAGCGTGACGTACCACGACGGGGGCAACGCGTCGTACAGG
CCAGAGGTGTCGCGTGCGGCGCTGGTGGATTTGCTGCTTTGGGCAACGGCCGAGGGAAGCATTCGCTGGGGGAGC
AAGGTGTGTGGCGTGCGGCAGAGAGGGGATGGCACAGTGGCGCTGCAGGTGAGCCGAGGAGAAGGAGGAGAAGCA
GACGAAAGCCAAAGCAGCAGCAGCAGAGATGAAGAGGGATGGAGCAGAGACGACGAGAGACGGAGCAGCAGAGAT
GAAGAGCAATGGAGCAGAGACAAGAGACGGAAGAGCAGCAAAGACGAGACCGAGTACGACGTCGTCATTGGCGCC
GACGGTGCTTGGTCGCGTGTCCGCAGCCTCGTGACGCCCGTCAAGCCCCATTACGGCGGCGTCTGCTACACAACC
CTGCGCATCGCCCAGGCCGAGCAACGCTACCCCCACCTCTCTGCCCTCGTCGGCCCCGGCACATGCTGCATCCTG
GGCAACGAGCGCGTCCTCTCCTCCCACCGCAGCATCGCCGGCTCCATTGTCCTGCACGCCAGCACCGCATCCGCC
ACCGAGGCCTCGATATGCGACGCCTCTCGCGGCCTCTCAACCGCCCAGATGGAAGAGCTCATGCTCCACGATGCC
CGCTTCTTTGGCGGCTGGGGCTGTCCCCTCGTCCGCCAGCTGCTCGCCACCGCCATTGCCAGCCAAGCCCAGCTG
CCGCCCTTTGAGCCTCCCGTCTTTAAGCCCATGTACATGCTCCCCGTGGGACACGCGTGGCCGGCAAACCAAGCC
TCGGCCACGCTTATTGGCGACGCGGCGCACCTCATGATGCCATGGGCAGGCGAGGGCGTCAATCTCGCGCTGCGC
GATGCCTTGGACTTGGCGGATGCGCTGGACGGAGCGTGGGGCGAGACTCGGGGCGGGCAGCAGGACGGGGGCTTG
TTTCGCGAGGCTCTGCGGCCGCGGCTGGCGCGCTTTGAAGAGGCCATGTTTGCGCGGGCGGCACAGGCGGCACAC
GAGACTTGGCAGAATAGCGGCATCTTTTTCGGCAGAGACAGTGCGCGCAGGTTGGGCGATTTGATGGCTGGATTC
ACGGCTCAGGGACAAGGGGAGAGATAG
Transcript >OphauB2|4753
ATGCCGCCACGCATTGCCATTGTGGGCGGTGGTCCTGCAGGCCTCTGTCTCGCCGCCCTGTTGCATCACCGCGGC
ATCCCCCTGACTCTGTATGAGCTGCGCCAGCGGCCGCCAGCGTCTGCCGTTTCGACGCCCTGCAGCATGCTCGAC
TTGCATCACGAGACGGGCCTAGCTGCTGTGCGCGCCTGTGGTCTGTGGGAGCGTCTTGCTCCACTCACCACGGCT
TGCGCCGAGAGCACCATTATCAGACGGCCCAATGGCAGCGTGACGTACCACGACGGGGGCAACGCGTCGTACAGG
CCAGAGGTGTCGCGTGCGGCGCTGGTGGATTTGCTGCTTTGGGCAACGGCCGAGGGAAGCATTCGCTGGGGGAGC
AAGGTGTGTGGCGTGCGGCAGAGAGGGGATGGCACAGTGGCGCTGCAGGTGAGCCGAGGAGAAGGAGGAGAAGCA
GACGAAAGCCAAAGCAGCAGCAGCAGAGATGAAGAGGGATGGAGCAGAGACGACGAGAGACGGAGCAGCAGAGAT
GAAGAGCAATGGAGCAGAGACAAGAGACGGAAGAGCAGCAAAGACGAGACCGAGTACGACGTCGTCATTGGCGCC
GACGGTGCTTGGTCGCGTGTCCGCAGCCTCGTGACGCCCGTCAAGCCCCATTACGGCGGCGTCTGCTACACAACC
CTGCGCATCGCCCAGGCCGAGCAACGCTACCCCCACCTCTCTGCCCTCGTCGGCCCCGGCACATGCTGCATCCTG
GGCAACGAGCGCGTCCTCTCCTCCCACCGCAGCATCGCCGGCTCCATTGTCCTGCACGCCAGCACCGCATCCGCC
ACCGAGGCCTCGATATGCGACGCCTCTCGCGGCCTCTCAACCGCCCAGATGGAAGAGCTCATGCTCCACGATGCC
CGCTTCTTTGGCGGCTGGGGCTGTCCCCTCGTCCGCCAGCTGCTCGCCACCGCCATTGCCAGCCAAGCCCAGCTG
CCGCCCTTTGAGCCTCCCGTCTTTAAGCCCATGTACATGCTCCCCGTGGGACACGCGTGGCCGGCAAACCAAGCC
TCGGCCACGCTTATTGGCGACGCGGCGCACCTCATGATGCCATGGGCAGGCGAGGGCGTCAATCTCGCGCTGCGC
GATGCCTTGGACTTGGCGGATGCGCTGGACGGAGCGTGGGGCGAGACTCGGGGCGGGCAGCAGGACGGGGGCTTG
TTTCGCGAGGCTCTGCGGCCGCGGCTGGCGCGCTTTGAAGAGGCCATGTTTGCGCGGGCGGCACAGGCGGCACAC
GAGACTTGGCAGAATAGCGGCATCTTTTTCGGCAGAGACAGTGCGCGCAGGTTGGGCGATTTGATGGCTGGATTC
ACGGCTCAGGGACAAGGGGAGAGATAG
Gene >OphauB2|4753
ATGCCGCCACGCATTGCCATTGTGGGCGGTGGTCCTGCAGGCCTCTGTCTCGCCGCCCTGTTGCATCACCGCGGC
ATCCCCCTGACTCTGTATGAGCTGCGCCAGCGGCCGCCAGCGTCTGCCGTTTCGACGCCCTGCAGCATGCTCGAC
TTGCATCACGAGACGGGCCTAGCTGCTGTGCGCGCCTGTGGTCTGTGGGAGCGTCTTGCTCCACTCACCACGGCT
TGCGCCGAGAGCACCATTATCAGACGGCCCAATGGCAGCGTGACGTACCACGACGGGGGCAACGCGTCGTACAGG
CCAGAGGTGTCGCGTGCGGCGCTGGTGGATTTGCTGCTTTGGGCAACGGCCGAGGGAAGCATTCGCTGGGGGAGC
AAGGTGTGTGGCGTGCGGCAGAGAGGGGATGGCACAGTGGCGCTGCAGGTGAGCCGAGGAGAAGGAGGAGAAGCA
GACGAAAGCCAAAGCAGCAGCAGCAGAGATGAAGAGGGATGGAGCAGAGACGACGAGAGACGGAGCAGCAGAGAT
GAAGAGCAATGGAGCAGAGACAAGAGACGGAAGAGCAGCAAAGACGAGACCGAGTACGACGTCGTCATTGGCGCC
GACGGTGCTTGGTCGCGTGTCCGCAGCCTCGTGACGCCCGTCAAGCCCCATTACGGCGGCGTCTGCTACACAACC
CTGCGCATCGCCCAGGCCGAGCAACGCTACCCCCACCTCTCTGCCCTCGTCGGCCCCGGCACATGCTGCATCCTG
GGCAACGAGCGCGTCCTCTCCTCCCACCGCAGCATCGCCGGCTCCATTGTCCTGCACGCCAGCACCGCATCCGCC
ACCGAGGCCTCGATATGCGACGCCTCTCGCGGCCTCTCAACCGCCCAGATGGAAGAGCTCATGCTCCACGATGCC
CGCTTCTTTGGCGGCTGGGGCTGTCCCCTCGTCCGCCAGCTGCTCGCCACCGCCATTGCCAGCCAAGCCCAGCTG
CCGCCCTTTGAGCCTCCCGTCTTTAAGCCCATGTACATGCTCCCCGTGGGACACGCGTGGCCGGCAAACCAAGCC
TCGGCCACGCTTATTGGCGACGCGGCGCACCTCATGATGCCATGGGCAGGCGAGGGCGTCAATCTCGCGCTGCGC
GATGCCTTGGACTTGGCGGATGCGCTGGACGGAGCGTGGGGCGAGACTCGGGGCGGGCAGCAGGACGGGGGCTTG
TTTCGCGAGGCTCTGCGGCCGCGGCTGGCGCGCTTTGAAGAGGCCATGTTTGCGCGGGCGGCACAGGCGGCACAC
GAGACTTGGCAGAATAGCGGCATCTTTTTCGGCAGAGACAGTGCGCGCAGGTTGGGCGATTTGATGGCTGGATTC
ACGGCTCAGGGACAAGGGGAGAGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail