Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|475
Gene name
LocationContig_107:44848..46846
Strand+
Gene length (bp)1998
Transcript length (bp)1845
Coding sequence length (bp)1845
Protein length (aa) 615

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 1.0E-18 190 394
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 2.1E-11 188 392
PF00743 FMO-like Flavin-binding monooxygenase-like 2.4E-11 188 535
PF13434 K_oxygenase L-lysine 6-monooxygenase (NADPH-requiring) 8.8E-10 263 393
PF01494 FAD_binding_3 FAD binding domain 3.0E-07 186 229

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 190 532 9.0E-29
sp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA4 OS=Arabidopsis thaliana GN=YUC4 PE=1 SV=1 190 532 9.0E-27
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 190 532 9.0E-27
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 190 532 7.0E-26
sp|Q8VZ59|YUC6_ARATH Indole-3-pyruvate monooxygenase YUCCA6 OS=Arabidopsis thaliana GN=YUC6 PE=1 SV=1 190 532 4.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 190 532 9.0E-29
sp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA4 OS=Arabidopsis thaliana GN=YUC4 PE=1 SV=1 190 532 9.0E-27
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 190 532 9.0E-27
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 190 532 7.0E-26
sp|Q8VZ59|YUC6_ARATH Indole-3-pyruvate monooxygenase YUCCA6 OS=Arabidopsis thaliana GN=YUC6 PE=1 SV=1 190 532 4.0E-25
sp|O64489|YUC9_ARATH Probable indole-3-pyruvate monooxygenase YUCCA9 OS=Arabidopsis thaliana GN=YUC9 PE=2 SV=1 190 532 2.0E-24
sp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=1 SV=1 190 534 2.0E-23
sp|O49312|YUC7_ARATH Probable indole-3-pyruvate monooxygenase YUCCA7 OS=Arabidopsis thaliana GN=YUC7 PE=2 SV=1 190 532 2.0E-23
sp|Q9LPL3|YUC11_ARATH Probable indole-3-pyruvate monooxygenase YUCCA11 OS=Arabidopsis thaliana GN=YUC11 PE=2 SV=1 183 532 2.0E-21
sp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=1 SV=1 190 532 4.0E-21
sp|Q9FVQ0|YUC10_ARATH Probable indole-3-pyruvate monooxygenase YUCCA10 OS=Arabidopsis thaliana GN=YUC10 PE=2 SV=1 186 534 1.0E-20
sp|P9WNF9|ETHA_MYCTU FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ethA PE=1 SV=1 185 529 9.0E-19
sp|P9WNF8|ETHA_MYCTO FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ethA PE=3 SV=1 185 529 9.0E-19
sp|Q7TVI2|ETHA_MYCBO FAD-containing monooxygenase EthA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ethA PE=1 SV=1 185 529 9.0E-19
sp|A0R665|ETHA_MYCS2 FAD-containing monooxygenase EthA OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ethA PE=3 SV=1 185 532 9.0E-16
sp|Q5L2G3|CZCO_GEOKA Uncharacterized oxidoreductase CzcO-like OS=Geobacillus kaustophilus (strain HTA426) GN=GK0582 PE=4 SV=1 187 393 7.0E-15
sp|Q8GAW0|CPMO_COMS9 Cyclopentanone 1,2-monooxygenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnB PE=1 SV=3 178 387 7.0E-15
sp|Q9RKB5|BVMO2_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3172 PE=1 SV=1 185 578 9.0E-15
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 179 531 2.0E-13
sp|Q47PU3|PAMO_THEFY Phenylacetone monooxygenase OS=Thermobifida fusca (strain YX) GN=pamO PE=1 SV=1 185 395 5.0E-13
sp|E3VWK3|PENE_STREX Pentalenolactone D synthase OS=Streptomyces exfoliatus GN=penE PE=1 SV=1 185 387 3.0E-12
sp|Q8SPQ7|FMO3_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Macaca mulatta GN=FMO3 PE=2 SV=3 188 547 3.0E-12
sp|E3VWI7|PNTE_STRAE Pentalenolactone D synthase OS=Streptomyces arenae GN=pntE PE=1 SV=1 185 387 8.0E-12
sp|Q88J44|BVMO_PSEPK Baeyer-Villiger monooxygenase OS=Pseudomonas putida (strain KT2440) GN=PP_2805 PE=1 SV=1 185 529 2.0E-11
sp|P9WNF7|MYMA_MYCTU Putative FAD-containing monooxygenase MymA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mymA PE=1 SV=1 184 529 2.0E-11
sp|P9WNF6|MYMA_MYCTO Putative FAD-containing monooxygenase MymA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mymA PE=3 SV=1 184 529 2.0E-11
sp|A3U3H1|BVMO_OCEBH Baeyer-Villiger monooxygenase OS=Oceanicola batsensis (strain ATCC BAA-863 / DSM 15984 / HTCC2597) GN=OB2597_18631 PE=1 SV=1 186 529 3.0E-11
sp|A7HU16|BVMO_PARL1 Baeyer-Villiger monooxygenase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=Plav_1781 PE=1 SV=1 185 529 3.0E-10
sp|Q9EQ76|FMO3_RAT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Rattus norvegicus GN=Fmo3 PE=1 SV=1 188 394 4.0E-10
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 188 574 6.0E-10
sp|Q9I3H5|BVMO_PSEAE Baeyer-Villiger monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1538 PE=1 SV=1 167 578 1.0E-09
sp|Q01740|FMO1_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Homo sapiens GN=FMO1 PE=2 SV=3 188 537 2.0E-09
sp|Q95LA1|FMO3_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Canis lupus familiaris GN=FMO3 PE=2 SV=3 188 394 3.0E-09
sp|P49109|FMO5_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Cavia porcellus GN=FMO5 PE=2 SV=2 188 537 7.0E-09
sp|P97501|FMO3_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Mus musculus GN=Fmo3 PE=1 SV=1 188 546 7.0E-09
sp|Q8K4C0|FMO5_RAT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Rattus norvegicus GN=Fmo5 PE=1 SV=3 188 537 2.0E-08
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 189 530 2.0E-08
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 189 530 2.0E-08
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 189 530 2.0E-08
sp|P50285|FMO1_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Mus musculus GN=Fmo1 PE=1 SV=1 188 384 2.0E-08
sp|O60774|FMO6_HUMAN Putative dimethylaniline monooxygenase [N-oxide-forming] 6 OS=Homo sapiens GN=FMO6P PE=5 SV=1 188 546 3.0E-08
sp|P55487|Y4ID_RHISN Uncharacterized monooxygenase y4iD OS=Rhizobium sp. (strain NGR234) GN=NGR_a03290 PE=3 SV=1 187 409 9.0E-08
sp|Q95LA2|FMO1_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Canis lupus familiaris GN=FMO1 PE=2 SV=3 188 371 1.0E-07
sp|P17636|FMO1_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Oryctolagus cuniculus GN=FMO1 PE=1 SV=3 188 384 1.0E-07
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 188 537 3.0E-07
sp|Q6IRI9|FMO2_RAT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Rattus norvegicus GN=Fmo2 PE=2 SV=3 188 537 4.0E-07
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 188 380 6.0E-07
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 188 380 9.0E-07
sp|P36365|FMO1_RAT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Rattus norvegicus GN=Fmo1 PE=1 SV=2 188 384 9.0E-07
sp|O07085|CZCO_BACSU Uncharacterized oxidoreductase CzcO OS=Bacillus subtilis (strain 168) GN=czcO PE=1 SV=1 190 391 9.0E-07
sp|Q99518|FMO2_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4 188 380 1.0E-06
sp|Q8K2I3|FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus GN=Fmo2 PE=1 SV=3 188 537 1.0E-06
sp|A7Z1S7|CZCO_BACMF Uncharacterized oxidoreductase CzcO OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=czcO PE=3 SV=1 190 393 2.0E-06
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 188 380 2.0E-06
sp|P12015|CHMO_ACISP Cyclohexanone 1,2-monooxygenase OS=Acinetobacter sp. PE=1 SV=2 183 393 3.0E-06
sp|Q8MP06|SNO1_TYRJA Senecionine N-oxygenase OS=Tyria jacobaeae GN=sno1 PE=1 SV=1 176 371 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050661 NADP binding Yes
GO:0071949 FAD binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0043168 anion binding No
GO:0000166 nucleotide binding No
GO:0004497 monooxygenase activity No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0048037 cofactor binding No
GO:0008152 metabolic process No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0008150 biological_process No
GO:0050662 coenzyme binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|475
MDGTPLPPLPTLILHDVKRDDVDAGKIVQEWLDKLQERLQQKPCQHLQDLFIQECWWRDIIGLDWDFTTKRGWQD
IADYINSSKHNLSELRCAETGGLKAALIEYGGCIWLQAAFSFKTAHGRGQGVVRLANVSAGEWKAWIVFTQLEQL
NFQEEREQHRLAAPAARLRALDQQGAGGAAQGQDEEIQVLIVGAGQAGLMLGARLRDMGIKTVLVERSARVGDSW
RARYKAVRLHTPTYTDHYPFIKYPENWPRWLPRDKVADFMETYAQIQSLHVLCNTLVSSAIYDEATRRWSVSIKT
GETLQTLHARHVVLATGVYSDNASTPIFANQDEFQGQCYHSSQHVSAAEMGDLADKKIAIIGSSTSAHDVAQDFV
EHGAQHVCMIQRQAIFSISSDAVEKHLFLLWNIPELNMSEADVLANSFPIALVRRMSIGLTRLMCQHDAAMVAGL
KQAGLALKTGEDGYGLADHQLLKGGHFYFDQGANSMIINGRIKIWQCPDGVERFVPEGVELGDGRRVEADIVVLA
TGFEQSICTVEDIMGSRVARVLESRAFGALDAEQERGGWWRATGVPGFWYMTGSFMWCRQFSQALALQIAAVERG
LNAEYYARNAWPQG*
Coding >OphauB2|475
ATGGACGGAACGCCCCTCCCCCCCTTGCCGACACTAATTCTCCACGACGTGAAGCGCGACGACGTGGACGCTGGC
AAAATTGTACAAGAATGGCTTGACAAGCTGCAGGAGCGGCTACAGCAAAAGCCGTGTCAGCATCTTCAAGACCTC
TTTATCCAGGAGTGCTGGTGGAGAGACATTATCGGGCTAGACTGGGACTTTACCACCAAGCGCGGCTGGCAAGAC
ATTGCAGATTATATCAACAGCAGCAAGCACAACCTTTCTGAGCTGCGATGCGCCGAGACTGGGGGGCTAAAGGCG
GCGCTGATTGAATACGGGGGATGCATCTGGCTCCAGGCAGCCTTTAGTTTCAAGACGGCCCACGGTCGAGGCCAG
GGCGTGGTGCGGCTGGCCAATGTCAGCGCTGGCGAGTGGAAGGCCTGGATCGTCTTTACGCAGCTCGAGCAGCTG
AATTTCCAAGAGGAGCGAGAGCAGCATCGACTTGCAGCCCCAGCGGCGCGGCTGCGAGCCTTGGACCAGCAAGGC
GCTGGAGGTGCAGCTCAAGGCCAAGATGAAGAGATTCAAGTCTTGATTGTCGGGGCGGGACAAGCCGGGCTTATG
CTGGGTGCGCGACTGCGCGACATGGGCATCAAGACGGTGCTGGTGGAAAGGAGTGCGCGGGTTGGAGACTCGTGG
AGGGCGCGGTACAAGGCGGTGAGGCTTCATACGCCAACGTATACTGACCACTATCCCTTTATCAAGTATCCAGAA
AACTGGCCACGATGGCTTCCGCGCGACAAGGTGGCCGACTTTATGGAAACCTATGCGCAAATACAGTCTCTACAT
GTCTTGTGCAACACGCTCGTTTCTTCAGCAATATATGACGAGGCCACGCGGCGGTGGAGCGTCAGCATCAAGACT
GGAGAAACATTACAGACGCTGCATGCTCGGCACGTGGTTCTTGCCACGGGAGTATACAGCGACAATGCCAGCACG
CCGATATTTGCCAACCAAGACGAGTTTCAAGGCCAGTGCTACCACTCTAGCCAGCACGTATCCGCAGCCGAAATG
GGAGACTTGGCGGACAAGAAGATTGCCATAATCGGAAGCAGCACCAGCGCGCACGACGTGGCGCAAGATTTCGTC
GAGCACGGCGCCCAGCACGTCTGCATGATTCAGCGCCAGGCCATTTTTTCCATCTCGTCCGACGCTGTGGAAAAG
CATCTTTTTCTTCTCTGGAATATCCCCGAGCTAAACATGAGCGAGGCAGACGTCTTGGCCAACTCGTTTCCCATT
GCGCTGGTGCGGCGCATGAGTATTGGGCTAACGCGCCTCATGTGCCAGCACGACGCGGCCATGGTTGCCGGGCTC
AAGCAGGCGGGGCTGGCGCTCAAGACGGGGGAGGATGGGTACGGGCTGGCAGACCACCAGCTGTTAAAGGGGGGG
CATTTCTACTTTGACCAGGGCGCAAACAGCATGATTATAAATGGGCGTATAAAGATTTGGCAGTGCCCGGACGGG
GTGGAGAGGTTTGTGCCCGAGGGGGTGGAGTTGGGGGATGGGAGGAGAGTAGAGGCAGACATTGTAGTCTTGGCG
ACGGGGTTTGAGCAGAGCATTTGCACGGTTGAGGACATTATGGGCAGCAGGGTGGCTCGAGTGTTGGAGTCGAGG
GCCTTTGGGGCGCTGGATGCAGAGCAGGAGCGCGGAGGGTGGTGGCGAGCAACGGGCGTGCCTGGGTTTTGGTAC
ATGACGGGAAGCTTCATGTGGTGTCGCCAGTTTTCGCAAGCCCTGGCGCTGCAGATTGCTGCGGTGGAAAGGGGG
CTAAATGCCGAGTATTATGCCAGGAATGCGTGGCCACAGGGCTGA
Transcript >OphauB2|475
ATGGACGGAACGCCCCTCCCCCCCTTGCCGACACTAATTCTCCACGACGTGAAGCGCGACGACGTGGACGCTGGC
AAAATTGTACAAGAATGGCTTGACAAGCTGCAGGAGCGGCTACAGCAAAAGCCGTGTCAGCATCTTCAAGACCTC
TTTATCCAGGAGTGCTGGTGGAGAGACATTATCGGGCTAGACTGGGACTTTACCACCAAGCGCGGCTGGCAAGAC
ATTGCAGATTATATCAACAGCAGCAAGCACAACCTTTCTGAGCTGCGATGCGCCGAGACTGGGGGGCTAAAGGCG
GCGCTGATTGAATACGGGGGATGCATCTGGCTCCAGGCAGCCTTTAGTTTCAAGACGGCCCACGGTCGAGGCCAG
GGCGTGGTGCGGCTGGCCAATGTCAGCGCTGGCGAGTGGAAGGCCTGGATCGTCTTTACGCAGCTCGAGCAGCTG
AATTTCCAAGAGGAGCGAGAGCAGCATCGACTTGCAGCCCCAGCGGCGCGGCTGCGAGCCTTGGACCAGCAAGGC
GCTGGAGGTGCAGCTCAAGGCCAAGATGAAGAGATTCAAGTCTTGATTGTCGGGGCGGGACAAGCCGGGCTTATG
CTGGGTGCGCGACTGCGCGACATGGGCATCAAGACGGTGCTGGTGGAAAGGAGTGCGCGGGTTGGAGACTCGTGG
AGGGCGCGGTACAAGGCGGTGAGGCTTCATACGCCAACGTATACTGACCACTATCCCTTTATCAAGTATCCAGAA
AACTGGCCACGATGGCTTCCGCGCGACAAGGTGGCCGACTTTATGGAAACCTATGCGCAAATACAGTCTCTACAT
GTCTTGTGCAACACGCTCGTTTCTTCAGCAATATATGACGAGGCCACGCGGCGGTGGAGCGTCAGCATCAAGACT
GGAGAAACATTACAGACGCTGCATGCTCGGCACGTGGTTCTTGCCACGGGAGTATACAGCGACAATGCCAGCACG
CCGATATTTGCCAACCAAGACGAGTTTCAAGGCCAGTGCTACCACTCTAGCCAGCACGTATCCGCAGCCGAAATG
GGAGACTTGGCGGACAAGAAGATTGCCATAATCGGAAGCAGCACCAGCGCGCACGACGTGGCGCAAGATTTCGTC
GAGCACGGCGCCCAGCACGTCTGCATGATTCAGCGCCAGGCCATTTTTTCCATCTCGTCCGACGCTGTGGAAAAG
CATCTTTTTCTTCTCTGGAATATCCCCGAGCTAAACATGAGCGAGGCAGACGTCTTGGCCAACTCGTTTCCCATT
GCGCTGGTGCGGCGCATGAGTATTGGGCTAACGCGCCTCATGTGCCAGCACGACGCGGCCATGGTTGCCGGGCTC
AAGCAGGCGGGGCTGGCGCTCAAGACGGGGGAGGATGGGTACGGGCTGGCAGACCACCAGCTGTTAAAGGGGGGG
CATTTCTACTTTGACCAGGGCGCAAACAGCATGATTATAAATGGGCGTATAAAGATTTGGCAGTGCCCGGACGGG
GTGGAGAGGTTTGTGCCCGAGGGGGTGGAGTTGGGGGATGGGAGGAGAGTAGAGGCAGACATTGTAGTCTTGGCG
ACGGGGTTTGAGCAGAGCATTTGCACGGTTGAGGACATTATGGGCAGCAGGGTGGCTCGAGTGTTGGAGTCGAGG
GCCTTTGGGGCGCTGGATGCAGAGCAGGAGCGCGGAGGGTGGTGGCGAGCAACGGGCGTGCCTGGGTTTTGGTAC
ATGACGGGAAGCTTCATGTGGTGTCGCCAGTTTTCGCAAGCCCTGGCGCTGCAGATTGCTGCGGTGGAAAGGGGG
CTAAATGCCGAGTATTATGCCAGGAATGCGTGGCCACAGGGCTGA
Gene >OphauB2|475
ATGGACGGAACGCCCCTCCCCCCCTTGCCGACACTAATTCTCCACGACGTGAAGCGCGACGACGTGGACGCTGGC
AAAATTGTACAAGAATGGCTTGACAAGCTGCAGGAGCGGCTACAGCAAAAGCCGTGTCAGCATCTTCAAGACCTC
TTTATCCAGGAGTGCTGGTGGAGAGACATTATCGGGCTAGACTGGGACTTTACCACCAAGCGCGGCTGGCAAGAC
ATTGCAGATTATATCAACAGCAGCAAGCACAACCTTTCTGAGCTGCGATGCGCCGAGACTGGGGGGCTAAAGGCG
GCGCTGATTGAATACGGGGGATGCATCTGGCTCCAGGCAGCCTTTAGTTTCAAGACGGCCCACGGTCGAGGCCAG
GGCGTGGTGCGGCTGGCCAATGTCAGCGCTGGCGAGTGGAAGGCCTGGATCGTCTTTACGCAGCTCGAGCAGCTG
AATTTCCAAGAGGAGCGAGAGCAGCATCGACTTGCAGCCCCAGCGGCGCGGCTGCGAGCCTTGGACCAGCAAGGC
GCTGGAGGTGCAGCTCAAGGCCAAGATGAAGAGATTCAAGTCTTGATTGTCGGGGCGGGTAAGGTTTTTGCACAA
GGGCGAGCATGGAGAGCGGTTGGGGCTGATGCTTGGGATAGGACAAGCCGGGCTTATGCTGGGTGCGCGACTGCG
CGACATGGGCATCAAGACGGTGCTGGTGGAAAGGAGTGCGCGGGTTGGAGACTCGTGGAGGGCGCGGTACAAGGC
GGTGAGGCTTCATACGCCAACGTATACTGACCACTATCCCTTTATCAAGTATCCAGAAAACTGGCCACGATGGCT
TCCGCGCGACAAGGTGGCCGACTTTATGGAAACCTATGCGCAAATACAGTCTCTACATGTCTTGTGCAACACGCT
CGTTTCTTCAGCAATATATGACGAGGCCACGCGGCGGTGGAGCGTCAGCATCAAGACTGGAGAAACATTACAGAC
GCTGCATGCTCGGCACGTGGTTCTTGCCACGGGAGTATACAGCGACAATGCCAGCACGCCGATATTTGCCAACCA
AGACGAGTTTCAAGGCCAGTGCTACCACTCTAGCCAGCACGTATCCGCAGCCGAAATGGGAGACTTGGCGGACAA
GAAGATTGCCATAATCGGAAGCAGCACCAGCGCGCACGACGTGGCGCAAGATTTCGTCGAGCACGGCGCCCAGCA
CGTCTGCATGATTCAGCGCCAGGCCATTTTTTCCATCTCGTCCGACGCTGTGGAAAAGCATCTTTTTCTTCTCTG
GAATATCCCCGAGCTAAACATGAGCGAGGCAGACGTCTTGGCCAACTCGTTTCCCATTGCGCTGGTGCGGCGCAT
GAGTATTGGGCTAACGCGCCTCATGTGCCAGCACGACGCGGCCATGGTTGCCGGGCTCAAGCAGGCGGGGCTGGC
GCTCAAGACGGGGGAGGATGGGTACGGGCTGGCAGACCACCAGCTGTTAAAGGGGGGGCATTTCTACTTTGACCA
GGGCGCAAACAGCATGATTATAAATGGGCGTATAAAGATTTGGCAGTGCCCGGACGGGGTGGAGAGGTTTGTGCC
CGAGGGGGTGGAGTTGGGGGATGGGAGGAGAGTAGAGGCAGACATTGTAGTCTTGGCGACGGGGTTTGAGCAGAG
CATTTGCACGGTTGAGGACATTATGGGCAGCAGGGTGGCTCGAGTGTTGGAGTCGAGGGCCTTTGGGGCGCTGGA
TGCAGAGCAGGAGCGCGGAGGGGCAAGTTTTTTTTTCTTTTCCTCTTTTTCCTCTTTTTCCTCTTCTTCTTCTTA
TTCACCGTGGAAAAGGCTGTATATGGGCTGACATTGGTTTAGTGGTGGCGAGCAACGGGCGTGCCTGGGTTTTGG
TACATGACGGGAAGCTTCATGTGGTGTCGCCAGTTTTCGCAAGCCCTGGCGCTGCAGATTGCTGCGGTGGAAAGG
GGGCTAAATGCCGAGTATTATGCCAGGAATGCGTGGCCACAGGGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail