Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4745
Gene name
LocationContig_328:5203..6105
Strand+
Gene length (bp)902
Transcript length (bp)450
Coding sequence length (bp)450
Protein length (aa) 150

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00036 EF-hand_1 EF hand 1.3E-09 12 40
PF00036 EF-hand_1 EF hand 1.4E-08 48 75
PF00036 EF-hand_1 EF hand 2.8E-09 85 112
PF00036 EF-hand_1 EF hand 6.8E-10 121 147
PF13499 EF-hand_7 EF-hand domain pair 2.2E-15 12 73
PF13499 EF-hand_7 EF-hand domain pair 2.5E-19 83 146
PF13833 EF-hand_8 EF-hand domain pair 1.3E-12 25 75
PF13833 EF-hand_8 EF-hand domain pair 3.5E-03 82 105
PF13833 EF-hand_8 EF-hand domain pair 4.2E-15 98 146
PF13405 EF-hand_6 EF-hand domain 1.1E-08 12 41
PF13405 EF-hand_6 EF-hand domain 1.5E-08 85 114
PF13202 EF-hand_5 EF hand 2.5E-06 14 37
PF13202 EF-hand_5 EF hand 2.3E-04 49 73
PF13202 EF-hand_5 EF hand 1.5E-05 86 110
PF13202 EF-hand_5 EF hand 5.3E-05 124 146
PF14658 EF-hand_9 EF-hand domain 1.8E-09 16 75

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P61859|CALM_NEUCR Calmodulin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cmd-1 PE=1 SV=2 1 149 2.0E-103
sp|Q9UWF0|CALM_MAGO7 Calmodulin OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CMD1 PE=3 SV=4 1 149 2.0E-103
sp|P61860|CALM_COLTR Calmodulin OS=Colletotrichum trifolii PE=3 SV=2 1 149 2.0E-103
sp|P61861|CALM_COLGL Calmodulin OS=Colletotrichum gloeosporioides PE=2 SV=2 1 149 2.0E-103
sp|P60204|CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=camA PE=3 SV=2 1 149 3.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P61859|CALM_NEUCR Calmodulin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cmd-1 PE=1 SV=2 1 149 2.0E-103
sp|Q9UWF0|CALM_MAGO7 Calmodulin OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CMD1 PE=3 SV=4 1 149 2.0E-103
sp|P61860|CALM_COLTR Calmodulin OS=Colletotrichum trifolii PE=3 SV=2 1 149 2.0E-103
sp|P61861|CALM_COLGL Calmodulin OS=Colletotrichum gloeosporioides PE=2 SV=2 1 149 2.0E-103
sp|P60204|CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=camA PE=3 SV=2 1 149 3.0E-103
sp|P60205|CALM_ASPOR Calmodulin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cmdA PE=3 SV=2 1 149 3.0E-103
sp|P60206|CALM_AJECG Calmodulin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CAM1 PE=2 SV=2 1 149 3.0E-103
sp|Q9GRJ1|CALM_LUMRU Calmodulin OS=Lumbricus rubellus PE=2 SV=3 1 149 1.0E-89
sp|Q7T3T2|CALM_EPIAK Calmodulin OS=Epinephelus akaara GN=calm PE=2 SV=3 1 149 2.0E-89
sp|P62155|CALM_XENLA Calmodulin OS=Xenopus laevis GN=calm1 PE=1 SV=2 1 149 2.0E-89
sp|P62151|CALM_TORCA Calmodulin OS=Torpedo californica PE=1 SV=2 1 149 2.0E-89
sp|Q6YNX6|CALM_SHEEP Calmodulin OS=Ovis aries GN=CALM2 PE=2 SV=3 1 149 2.0E-89
sp|P62161|CALM_RAT Calmodulin OS=Rattus norvegicus GN=Calm1 PE=1 SV=2 1 149 2.0E-89
sp|P62160|CALM_RABIT Calmodulin OS=Oryctolagus cuniculus GN=CALM PE=1 SV=2 1 149 2.0E-89
sp|Q5RAD2|CALM_PONAB Calmodulin OS=Pongo abelii GN=CALM PE=2 SV=3 1 149 2.0E-89
sp|Q71UH6|CALM_PERFV Calmodulin OS=Perca flavescens GN=calm PE=2 SV=3 1 149 2.0E-89
sp|P62156|CALM_ONCSP Calmodulin OS=Oncorhynchus sp. GN=calm PE=1 SV=2 1 149 2.0E-89
sp|P62204|CALM_MOUSE Calmodulin OS=Mus musculus GN=Calm1 PE=1 SV=2 1 149 2.0E-89
sp|P62158|CALM_HUMAN Calmodulin OS=Homo sapiens GN=CALM1 PE=1 SV=2 1 149 2.0E-89
sp|Q6PI52|CALM_DANRE Calmodulin OS=Danio rerio GN=calm1a PE=2 SV=3 1 149 2.0E-89
sp|Q6IT78|CALM_CTEID Calmodulin OS=Ctenopharyngodon idella GN=calm PE=2 SV=3 1 149 2.0E-89
sp|P62149|CALM_CHICK Calmodulin OS=Gallus gallus GN=CALM PE=1 SV=2 1 149 2.0E-89
sp|P62157|CALM_BOVIN Calmodulin OS=Bos taurus GN=CALM PE=1 SV=2 1 149 2.0E-89
sp|P62144|CALM_ANAPL Calmodulin OS=Anas platyrhynchos GN=CALM PE=2 SV=2 1 149 2.0E-89
sp|Q71UH5|CALM_PYTSP Calmodulin OS=Pythium splendens PE=2 SV=1 1 149 3.0E-89
sp|P27165|CALM_PHYIN Calmodulin OS=Phytophthora infestans GN=CMD1 PE=3 SV=2 1 149 3.0E-89
sp|Q40302|CALM_MACPY Calmodulin OS=Macrocystis pyrifera PE=2 SV=3 1 149 4.0E-89
sp|O94739|CALM_PLEOS Calmodulin OS=Pleurotus ostreatus GN=CMD1 PE=2 SV=3 1 149 4.0E-89
sp|Q95NR9|CALM_METSE Calmodulin OS=Metridium senile PE=1 SV=3 1 149 5.0E-89
sp|P11120|CALM_PLECO Calmodulin OS=Pleurotus cornucopiae GN=CMD1 PE=1 SV=2 1 149 6.0E-89
sp|P02594|CALM_ELEEL Calmodulin OS=Electrophorus electricus GN=calm PE=2 SV=2 1 149 8.0E-89
sp|P62154|CALM_LOCMI Calmodulin OS=Locusta migratoria PE=1 SV=2 1 149 8.0E-89
sp|P62152|CALM_DROME Calmodulin OS=Drosophila melanogaster GN=Cam PE=1 SV=2 1 149 8.0E-89
sp|O02367|CALM_CIOIN Calmodulin OS=Ciona intestinalis PE=2 SV=3 1 149 8.0E-89
sp|P62145|CALM_APLCA Calmodulin OS=Aplysia californica GN=CAM PE=2 SV=2 1 149 8.0E-89
sp|P62153|CALMA_HALRO Calmodulin-A OS=Halocynthia roretzi PE=1 SV=2 1 149 8.0E-89
sp|P62148|CALM1_BRALA Calmodulin-1 OS=Branchiostoma lanceolatum PE=2 SV=2 1 149 8.0E-89
sp|P62147|CALM1_BRAFL Calmodulin-1 OS=Branchiostoma floridae PE=2 SV=2 1 149 8.0E-89
sp|Q9U6D3|CALM_MYXGL Calmodulin OS=Myxine glutinosa PE=2 SV=3 1 149 9.0E-89
sp|Q9UB37|CALM2_BRALA Calmodulin-2 OS=Branchiostoma lanceolatum GN=CAM2 PE=2 SV=3 1 149 9.0E-89
sp|O16305|CALM_CAEEL Calmodulin OS=Caenorhabditis elegans GN=cmd-1 PE=1 SV=3 1 149 1.0E-88
sp|O96102|CALM_PHYPO Calmodulin OS=Physarum polycephalum PE=2 SV=3 1 149 1.0E-88
sp|P21251|CALM_STIJA Calmodulin OS=Stichopus japonicus PE=1 SV=2 1 149 1.0E-88
sp|Q8X187|CALM_PAXIN Calmodulin OS=Paxillus involutus GN=calA PE=2 SV=3 1 149 1.0E-88
sp|A8CEP3|CALM_SACJA Calmodulin OS=Saccharina japonica GN=cam PE=2 SV=1 1 149 2.0E-88
sp|P84339|CALM_AGABI Calmodulin OS=Agaricus bisporus PE=1 SV=2 1 149 3.0E-88
sp|A3E4D8|CALM_PROMN Calmodulin OS=Prorocentrum minimum PE=2 SV=1 1 149 3.0E-88
sp|A3E3H0|CALM_PFIPI Calmodulin OS=Pfiesteria piscicida PE=2 SV=1 1 149 3.0E-88
sp|A3E4F9|CALM_KARVE Calmodulin OS=Karlodinium veneficum PE=2 SV=1 1 149 3.0E-88
sp|A4UHC0|CALM_ALEFU Calmodulin OS=Alexandrium fundyense PE=2 SV=1 1 149 3.0E-88
sp|Q8STF0|CALM_STRIE Calmodulin OS=Strongylocentrotus intermedius PE=2 SV=3 2 149 5.0E-88
sp|O96081|CALMB_HALRO Calmodulin-B OS=Halocynthia roretzi PE=3 SV=3 1 149 5.0E-88
sp|Q9XZP2|CALM2_BRAFL Calmodulin-2 OS=Branchiostoma floridae GN=CAM2 PE=2 SV=4 1 149 6.0E-88
sp|P11121|CALM_PYUSP Calmodulin OS=Pyuridae sp. PE=1 SV=2 1 149 7.0E-88
sp|Q7DMN9|CALM5_SOLTU Calmodulin-5/6/7/8 OS=Solanum tuberosum GN=PCM5 PE=1 SV=3 1 149 8.0E-88
sp|Q6R520|CALM_OREMO Calmodulin OS=Oreochromis mossambicus GN=calm PE=2 SV=3 1 149 1.0E-87
sp|O97341|CALM_SUBDO Calmodulin OS=Suberites domuncula PE=2 SV=3 1 149 1.0E-87
sp|P17928|CALM_MEDSA Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2 1 149 1.0E-87
sp|P93171|CALM_HELAN Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3 1 149 1.0E-87
sp|A8I1Q0|CALM_HETTR Calmodulin OS=Heterocapsa triquetra PE=2 SV=1 1 149 1.0E-87
sp|P27166|CALM_STYLE Calmodulin OS=Stylonychia lemnae PE=3 SV=2 1 149 2.0E-87
sp|Q95NI4|CALM_HALOK Calmodulin OS=Halichondria okadai PE=2 SV=3 1 149 2.0E-87
sp|P62184|CALM_RENRE Calmodulin OS=Renilla reniformis PE=1 SV=2 1 149 2.0E-87
sp|P02598|CALM_TETPY Calmodulin OS=Tetrahymena pyriformis PE=1 SV=4 1 149 3.0E-87
sp|P93087|CALM_CAPAN Calmodulin OS=Capsicum annuum GN=CCM1 PE=2 SV=3 1 149 3.0E-87
sp|P02595|CALM_PATSP Calmodulin OS=Patinopecten sp. PE=1 SV=2 1 149 5.0E-87
sp|P62201|CALM_LILLO Calmodulin OS=Lilium longiflorum PE=2 SV=2 1 149 5.0E-87
sp|Q7Y052|CALM_EUPCH Calmodulin OS=Euphorbia characias PE=2 SV=4 1 149 5.0E-87
sp|P62202|CALM_BRYDI Calmodulin OS=Bryonia dioica PE=2 SV=2 1 149 5.0E-87
sp|P59220|CALM7_ARATH Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 SV=2 1 149 5.0E-87
sp|P62199|CALM1_PETHY Calmodulin-1 OS=Petunia hybrida GN=CAM81 PE=1 SV=2 1 149 5.0E-87
sp|P62200|CALM1_DAUCA Calmodulin-1/11/16 OS=Daucus carota GN=CAM-1 PE=2 SV=2 1 149 5.0E-87
sp|O82018|CALM_MOUSC Calmodulin OS=Mougeotia scalaris PE=2 SV=3 1 149 7.0E-87
sp|A2WNH1|CALM3_ORYSI Calmodulin-3 OS=Oryza sativa subsp. indica GN=CAM3 PE=3 SV=2 1 149 7.0E-87
sp|Q6F332|CALM2_ORYSJ Calmodulin-2 OS=Oryza sativa subsp. japonica GN=CAM2 PE=2 SV=3 1 149 9.0E-87
sp|A2Y609|CALM2_ORYSI Calmodulin-2 OS=Oryza sativa subsp. indica GN=CAM2 PE=3 SV=1 1 149 9.0E-87
sp|P62162|CALM_HORVU Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2 1 149 1.0E-86
sp|P62163|CALM2_SOYBN Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1 SV=2 1 149 1.0E-86
sp|Q0JNS6|CALM1_ORYSJ Calmodulin-1 OS=Oryza sativa subsp. japonica GN=CAM1-1 PE=1 SV=2 1 149 1.0E-86
sp|A2WN93|CALM1_ORYSI Calmodulin-1 OS=Oryza sativa subsp. indica GN=CAM1-1 PE=1 SV=2 1 149 1.0E-86
sp|P0DH96|CALM4_ARATH Calmodulin-4 OS=Arabidopsis thaliana GN=CAM4 PE=1 SV=1 1 149 1.0E-86
sp|P0DH95|CALM1_ARATH Calmodulin-1 OS=Arabidopsis thaliana GN=CAM1 PE=2 SV=1 1 149 1.0E-86
sp|Q682T9|CALM5_ARATH Calmodulin-5 OS=Arabidopsis thaliana GN=CAM5 PE=1 SV=1 1 149 1.0E-86
sp|P0DH98|CALM3_ARATH Calmodulin-3 OS=Arabidopsis thaliana GN=CAM3 PE=1 SV=1 1 149 1.0E-86
sp|P0DH97|CALM2_ARATH Calmodulin-2 OS=Arabidopsis thaliana GN=CAM2 PE=1 SV=1 1 149 1.0E-86
sp|P04353|CALM_SPIOL Calmodulin OS=Spinacia oleracea PE=1 SV=2 1 149 1.0E-86
sp|P41040|CALM_MAIZE Calmodulin OS=Zea mays GN=CALM1 PE=2 SV=2 1 149 1.0E-86
sp|Q03509|CALM6_ARATH Calmodulin-6 OS=Arabidopsis thaliana GN=CAM6 PE=1 SV=2 1 149 2.0E-86
sp|P04464|CALM_WHEAT Calmodulin OS=Triticum aestivum PE=1 SV=3 1 149 2.0E-86
sp|P27164|CALM3_PETHY Calmodulin-related protein OS=Petunia hybrida GN=CAM53 PE=2 SV=2 1 147 2.0E-86
sp|P27161|CALM_SOLLC Calmodulin OS=Solanum lycopersicum GN=CALM1 PE=2 SV=2 1 149 2.0E-86
sp|Q0JNL7|CALM3_ORYSJ Calmodulin-3 OS=Oryza sativa subsp. japonica GN=CAM3 PE=3 SV=1 1 149 3.0E-86
sp|Q9HFY6|CALM_BLAEM Calmodulin OS=Blastocladiella emersonii GN=CMD1 PE=3 SV=3 1 149 3.0E-86
sp|P62146|CALMA_ARBPU Calmodulin-alpha (Fragment) OS=Arbacia punctulata PE=1 SV=2 1 142 4.0E-86
sp|P02599|CALM_DICDI Calmodulin OS=Dictyostelium discoideum GN=calA PE=1 SV=3 3 149 5.0E-86
sp|P41041|CALM_PNECA Calmodulin OS=Pneumocystis carinii PE=3 SV=1 4 149 6.0E-86
sp|P13868|CALM1_SOLTU Calmodulin-1 OS=Solanum tuberosum GN=PCM1 PE=1 SV=2 1 149 8.0E-86
sp|P18061|CALM_TRYCR Calmodulin OS=Trypanosoma cruzi GN=CALA2 PE=3 SV=2 1 149 9.0E-86
sp|P48976|CALM_MALDO Calmodulin OS=Malus domestica GN=CAM PE=3 SV=2 1 149 2.0E-85
sp|P69098|CALM_TRYBG Calmodulin OS=Trypanosoma brucei gambiense PE=3 SV=2 1 149 2.0E-85
sp|P69097|CALM_TRYBB Calmodulin OS=Trypanosoma brucei brucei PE=3 SV=2 1 149 2.0E-85
sp|P15094|CALM_ACHKL Calmodulin OS=Achlya klebsiana GN=CMD1 PE=3 SV=3 1 149 3.0E-85
sp|P27163|CALM2_PETHY Calmodulin-2 OS=Petunia hybrida GN=CAM72 PE=2 SV=2 1 149 3.0E-85
sp|P11118|CALM_EUGGR Calmodulin OS=Euglena gracilis PE=1 SV=2 1 149 4.0E-85
sp|P07463|CALM_PARTE Calmodulin OS=Paramecium tetraurelia GN=CAM PE=1 SV=3 1 149 5.0E-85
sp|Q39752|CALM_FAGSY Calmodulin OS=Fagus sylvatica GN=CAMF1 PE=2 SV=3 1 149 4.0E-84
sp|P24044|CALM_PLAFA Calmodulin OS=Plasmodium falciparum PE=3 SV=4 1 149 1.0E-83
sp|P62203|CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0323 PE=3 SV=2 1 149 1.0E-83
sp|Q5U206|CALL3_RAT Calmodulin-like protein 3 OS=Rattus norvegicus GN=Calml3 PE=2 SV=1 1 149 2.0E-83
sp|Q9D6P8|CALL3_MOUSE Calmodulin-like protein 3 OS=Mus musculus GN=Calml3 PE=2 SV=1 1 149 2.0E-83
sp|P53440|CALMF_NAEGR Calmodulin, flagellar OS=Naegleria gruberi GN=CAM1 PE=2 SV=1 5 149 1.0E-82
sp|P62150|CALM_ORYLA Calmodulin-A (Fragment) OS=Oryzias latipes GN=calm1 PE=2 SV=1 8 143 2.0E-82
sp|P27482|CALL3_HUMAN Calmodulin-like protein 3 OS=Homo sapiens GN=CALML3 PE=1 SV=2 1 149 4.0E-82
sp|P05932|CALMB_ARBPU Calmodulin-beta (Fragment) OS=Arbacia punctulata PE=2 SV=1 12 149 8.0E-82
sp|P04352|CALM_CHLRE Calmodulin OS=Chlamydomonas reinhardtii PE=1 SV=2 3 146 7.0E-81
sp|P02597|CALMS_CHICK Calmodulin, striated muscle OS=Gallus gallus GN=CCM1 PE=3 SV=2 1 149 1.0E-80
sp|P05419|CALN_CHICK Neo-calmodulin (Fragment) OS=Gallus gallus PE=2 SV=1 12 142 9.0E-80
sp|Q40642|CML1_ORYSI Calmodulin-like protein 1 OS=Oryza sativa subsp. indica GN=CML1 PE=1 SV=1 1 149 9.0E-79
sp|Q8S1Y9|CML1_ORYSJ Calmodulin-like protein 1 OS=Oryza sativa subsp. japonica GN=CML1 PE=2 SV=1 1 149 2.0E-77
sp|P23286|CALM_CANAX Calmodulin OS=Candida albicans GN=CMD1 PE=3 SV=2 1 149 1.0E-75
sp|Q7DMP0|CALM2_SOLTU Calmodulin-2/4 (Fragment) OS=Solanum tuberosum GN=PCM2 PE=2 SV=1 26 149 3.0E-71
sp|P05933|CALM_SCHPO Calmodulin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cam1 PE=1 SV=1 4 149 1.0E-70
sp|Q9LIK5|CML11_ARATH Calmodulin-like protein 11 OS=Arabidopsis thaliana GN=CML11 PE=2 SV=1 5 147 1.0E-68
sp|O23320|CML8_ARATH Calmodulin-like protein 8 OS=Arabidopsis thaliana GN=CML8 PE=2 SV=1 4 147 1.0E-67
sp|Q41420|CALM3_SOLTU Putative calmodulin-3 (Fragment) OS=Solanum tuberosum GN=PCM3 PE=5 SV=1 26 149 9.0E-67
sp|Q0IUU4|CML2_ORYSJ Putative calmodulin-like protein 2 OS=Oryza sativa subsp. japonica GN=CML2 PE=3 SV=2 3 149 3.0E-66
sp|Q0IQB6|CML3_ORYSJ Calmodulin-like protein 3 OS=Oryza sativa subsp. japonica GN=CML3 PE=2 SV=1 3 149 1.0E-64
sp|P49258|CALL_DROME Calmodulin-related protein 97A OS=Drosophila melanogaster GN=Acam PE=1 SV=2 5 149 2.0E-64
sp|O60041|CALM_KLULA Calmodulin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CMD1 PE=1 SV=1 1 146 2.0E-59
sp|P06787|CALM_YEAST Calmodulin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMD1 PE=1 SV=1 1 146 5.0E-59
sp|P04630|CALL_CAEEL Calmodulin-like protein OS=Caenorhabditis elegans GN=cal-1 PE=3 SV=1 5 146 1.0E-58
sp|Q84MN0|CML4_ORYSJ Calmodulin-like protein 4 OS=Oryza sativa subsp. japonica GN=CML4 PE=2 SV=1 3 146 2.0E-58
sp|P14533|CABO_DORPE Squidulin OS=Doryteuthis pealeii PE=1 SV=1 2 149 3.0E-58
sp|Q948R0|CML5_ORYSJ Calmodulin-like protein 5 OS=Oryza sativa subsp. japonica GN=CML5 PE=2 SV=1 5 147 5.0E-58
sp|P30187|CML10_ARATH Calmodulin-like protein 10 OS=Arabidopsis thaliana GN=CML10 PE=2 SV=1 1 149 2.0E-52
sp|Q2R1Z5|CML6_ORYSJ Putative calmodulin-like protein 6 OS=Oryza sativa subsp. japonica GN=CML6 PE=3 SV=1 1 147 1.0E-49
sp|P02589|TNNC2_PELES Troponin C, skeletal muscle OS=Pelophylax esculentus PE=1 SV=1 5 146 4.0E-47
sp|P02586|TNNC2_RABIT Troponin C, skeletal muscle OS=Oryctolagus cuniculus GN=TNNC2 PE=1 SV=2 5 146 9.0E-47
sp|P25071|CML12_ARATH Calmodulin-like protein 12 OS=Arabidopsis thaliana GN=CML12 PE=1 SV=3 1 149 1.0E-46
sp|P02587|TNNC2_PIG Troponin C, skeletal muscle OS=Sus scrofa GN=TNNC2 PE=1 SV=2 5 146 2.0E-46
sp|P10246|TNNC2_MELGA Troponin C, skeletal muscle OS=Meleagris gallopavo GN=TNNC2 PE=1 SV=2 5 146 3.0E-46
sp|P20801|TNNC2_MOUSE Troponin C, skeletal muscle OS=Mus musculus GN=Tnnc2 PE=1 SV=2 5 146 4.0E-46
sp|P02588|TNNC2_CHICK Troponin C, skeletal muscle OS=Gallus gallus GN=TNNC2 PE=1 SV=3 5 146 7.0E-46
sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle OS=Homo sapiens GN=TNNC2 PE=1 SV=2 5 146 7.0E-46
sp|P25071|CML12_ARATH Calmodulin-like protein 12 OS=Arabidopsis thaliana GN=CML12 PE=1 SV=3 1 148 7.0E-45
sp|P81660|TNNC2_ANGAN Troponin C, skeletal muscle OS=Anguilla anguilla PE=1 SV=1 5 146 1.0E-44
sp|P05434|CATR_CHLRE Caltractin OS=Chlamydomonas reinhardtii PE=1 SV=1 5 146 3.0E-44
sp|O00897|CALML_DICDI Calmodulin-like protein OS=Dictyostelium discoideum GN=calB PE=2 SV=1 13 146 4.0E-44
sp|P19123|TNNC1_MOUSE Troponin C, slow skeletal and cardiac muscles OS=Mus musculus GN=Tnnc1 PE=1 SV=1 2 146 4.0E-44
sp|P63317|TNNC1_PIG Troponin C, slow skeletal and cardiac muscles OS=Sus scrofa GN=TNNC1 PE=1 SV=1 2 146 5.0E-44
sp|P63315|TNNC1_BOVIN Troponin C, slow skeletal and cardiac muscles OS=Bos taurus GN=TNNC1 PE=1 SV=1 2 146 5.0E-44
sp|P02591|TNNC1_RABIT Troponin C, slow skeletal and cardiac muscles OS=Oryctolagus cuniculus GN=TNNC1 PE=1 SV=1 2 146 8.0E-44
sp|P63316|TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles OS=Homo sapiens GN=TNNC1 PE=1 SV=1 2 146 8.0E-44
sp|P54213|CATR_DUNSA Caltractin OS=Dunaliella salina PE=2 SV=1 4 146 1.0E-43
sp|P09860|TNNC1_CHICK Troponin C, slow skeletal and cardiac muscles OS=Gallus gallus GN=TNNC1 PE=1 SV=1 2 146 1.0E-43
sp|P05936|TNNC1_COTJA Troponin C, slow skeletal and cardiac muscles OS=Coturnix coturnix japonica GN=TNNC1 PE=2 SV=1 2 146 3.0E-43
sp|Q8VZ50|CML14_ARATH Probable calcium-binding protein CML14 OS=Arabidopsis thaliana GN=CML14 PE=2 SV=1 3 149 2.0E-42
sp|Q06827|CATR_SCHDU Caltractin OS=Scherffelia dubia PE=1 SV=1 5 146 6.0E-42
sp|P43645|CATR_SPESI Caltractin (Fragment) OS=Spermatozopsis similis PE=2 SV=1 5 146 8.0E-42
sp|Q94AZ4|CML13_ARATH Probable calcium-binding protein CML13 OS=Arabidopsis thaliana GN=CML13 PE=2 SV=1 3 149 8.0E-42
sp|Q84VG0|CML7_ORYSJ Probable calcium-binding protein CML7 OS=Oryza sativa subsp. japonica GN=CML7 PE=2 SV=1 5 149 1.0E-41
sp|P43646|CATR_TETST Caltractin (Fragment) OS=Tetraselmis striata PE=2 SV=1 5 146 2.0E-41
sp|P41208|CETN2_HUMAN Centrin-2 OS=Homo sapiens GN=CETN2 PE=1 SV=1 5 146 6.0E-41
sp|Q2TBN3|CETN2_BOVIN Centrin-2 OS=Bos taurus GN=CETN2 PE=2 SV=1 5 146 8.0E-41
sp|Q9S744|CML9_ARATH Calmodulin-like protein 9 OS=Arabidopsis thaliana GN=CML9 PE=1 SV=1 1 147 1.0E-40
sp|Q9R1K9|CETN2_MOUSE Centrin-2 OS=Mus musculus GN=Cetn2 PE=1 SV=1 5 146 1.0E-40
sp|P80322|TNNC_BRALA Troponin C OS=Branchiostoma lanceolatum PE=1 SV=1 5 148 2.0E-40
sp|Q7Z2B8|MLCD_DICDI Myosin-ID light chain OS=Dictyostelium discoideum GN=mlcD PE=1 SV=1 1 149 1.0E-39
sp|P41209|CETN1_MOUSE Centrin-1 OS=Mus musculus GN=Cetn1 PE=1 SV=1 5 146 1.0E-39
sp|P05934|CALM_STRPU Calmodulin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=1 70 149 2.0E-39
sp|Q32LE3|CETN1_BOVIN Centrin-1 OS=Bos taurus GN=CETN1 PE=2 SV=1 5 146 3.0E-39
sp|Q12798|CETN1_HUMAN Centrin-1 OS=Homo sapiens GN=CETN1 PE=1 SV=1 5 146 3.0E-39
sp|Q338P8|CML8_ORYSJ Probable calcium-binding protein CML8 OS=Oryza sativa subsp. japonica GN=CML8 PE=2 SV=1 5 146 3.0E-38
sp|P15159|TNNC_TACTR Troponin C OS=Tachypleus tridentatus PE=1 SV=1 2 146 3.0E-38
sp|Q9NZT1|CALL5_HUMAN Calmodulin-like protein 5 OS=Homo sapiens GN=CALML5 PE=1 SV=2 1 148 6.0E-38
sp|Q9LQN4|CML17_ARATH Probable calcium-binding protein CML17 OS=Arabidopsis thaliana GN=CML17 PE=2 SV=1 1 144 6.0E-38
sp|Q6F334|CML9_ORYSJ Probable calcium-binding protein CML9 OS=Oryza sativa subsp. japonica GN=CML9 PE=2 SV=1 1 147 3.0E-37
sp|P53441|CATR_NAEGR Caltractin OS=Naegleria gruberi GN=CTN PE=2 SV=1 5 146 5.0E-37
sp|Q8K4K1|CETN4_MOUSE Centrin-4 OS=Mus musculus GN=Cetn4 PE=1 SV=1 5 146 1.0E-36
sp|Q3SB11|CALGL_TROCA Calglandulin OS=Tropidechis carinatus PE=2 SV=1 1 146 6.0E-36
sp|Q7F0J0|CML13_ORYSJ Probable calcium-binding protein CML13 OS=Oryza sativa subsp. japonica GN=CML13 PE=2 SV=1 4 146 7.0E-36
sp|Q3SB13|CALGL_PSETE Calglandulin OS=Pseudonaja textilis PE=2 SV=1 1 146 8.0E-36
sp|Q3SB08|CALGL_PSEPO Calglandulin OS=Pseudechis porphyriacus PE=2 SV=1 1 146 8.0E-36
sp|Q3SB09|CALGL_PSEAU Calglandulin OS=Pseudechis australis PE=2 SV=1 1 146 8.0E-36
sp|Q3SB15|CALGL_OXYSC Calglandulin OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 1 146 8.0E-36
sp|Q3SB14|CALGL_OXYMI Calglandulin OS=Oxyuranus microlepidotus PE=2 SV=1 1 146 8.0E-36
sp|Q3SB12|CALGL_NOTSC Calglandulin OS=Notechis scutatus scutatus PE=2 SV=1 1 146 8.0E-36
sp|Q3SB10|CALGL_HOPST Calglandulin OS=Hoplocephalus stephensii PE=2 SV=1 1 146 8.0E-36
sp|Q9JM83|CALM4_MOUSE Calmodulin-4 OS=Mus musculus GN=Calm4 PE=2 SV=2 1 148 8.0E-36
sp|Q8AY75|CALGL_BOTIN Calglandulin OS=Bothrops insularis PE=2 SV=1 1 146 1.0E-35
sp|O14008|CAM2_SCHPO Myosin 1 light chain cam2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cam2 PE=1 SV=1 6 149 2.0E-35
sp|Q96GE6|CALL4_HUMAN Calmodulin-like protein 4 OS=Homo sapiens GN=CALML4 PE=2 SV=3 1 144 3.0E-35
sp|Q3T0E8|CALL4_BOVIN Calmodulin-like protein 4 OS=Bos taurus GN=CALML4 PE=2 SV=1 1 144 4.0E-35
sp|P41210|CATR_ATRNU Caltractin OS=Atriplex nummularia PE=2 SV=1 4 146 6.0E-35
sp|P06706|TNNC_HALRO Troponin C, body wall muscle OS=Halocynthia roretzi PE=1 SV=2 2 146 7.0E-35
sp|Q8TD86|CALL6_HUMAN Calmodulin-like protein 6 OS=Homo sapiens GN=CALML6 PE=2 SV=2 1 146 9.0E-35
sp|O82659|CML20_ARATH Probable calcium-binding protein CML20 OS=Arabidopsis thaliana GN=CML20 PE=1 SV=1 4 146 1.0E-34
sp|P02607|MYL6_CHICK Myosin light polypeptide 6 OS=Gallus gallus GN=MYL6 PE=1 SV=3 1 147 2.0E-34
sp|Q09665|TNNC2_CAEEL Troponin C, isoform 2 OS=Caenorhabditis elegans GN=tnc-2 PE=2 SV=1 3 146 2.0E-34
sp|P47947|TNNC1_DROME Troponin C, isoform 1 OS=Drosophila melanogaster GN=TpnC41C PE=2 SV=2 1 146 2.0E-34
sp|Q5R844|MYL6_PONAB Myosin light polypeptide 6 OS=Pongo abelii GN=MYL6 PE=2 SV=3 1 147 4.0E-34
sp|P60662|MYL6_PIG Myosin light polypeptide 6 OS=Sus scrofa GN=MYL6 PE=1 SV=2 1 147 4.0E-34
sp|Q60605|MYL6_MOUSE Myosin light polypeptide 6 OS=Mus musculus GN=Myl6 PE=1 SV=3 1 147 4.0E-34
sp|P60660|MYL6_HUMAN Myosin light polypeptide 6 OS=Homo sapiens GN=MYL6 PE=1 SV=2 1 147 4.0E-34
sp|P60661|MYL6_BOVIN Myosin light polypeptide 6 OS=Bos taurus GN=MYL6 PE=2 SV=2 1 147 4.0E-34
sp|Q64119|MYL6_RAT Myosin light polypeptide 6 OS=Rattus norvegicus GN=Myl6 PE=1 SV=3 1 147 5.0E-34
sp|P54357|MLC2_DROME Myosin-2 essential light chain OS=Drosophila melanogaster GN=Mlc-c PE=1 SV=1 4 147 5.0E-34
sp|O23184|CML19_ARATH Calcium-binding protein CML19 OS=Arabidopsis thaliana GN=CML19 PE=1 SV=1 5 146 5.0E-33
sp|Q91WQ9|CALL4_MOUSE Calmodulin-like protein 4 OS=Mus musculus GN=Calml4 PE=1 SV=2 1 144 7.0E-33
sp|Q9AWK2|CML11_ORYSJ Probable calcium-binding protein CML11 OS=Oryza sativa subsp. japonica GN=CML11 PE=2 SV=1 3 146 9.0E-33
sp|Q5ZD81|CML12_ORYSJ Probable calcium-binding protein CML12 OS=Oryza sativa subsp. japonica GN=CML12 PE=2 SV=1 5 149 2.0E-32
sp|Q3SEK2|CATR6_PARTE Caltractin ICL1f OS=Paramecium tetraurelia GN=Icl1f PE=3 SV=1 5 149 2.0E-32
sp|P29289|TNNC1_HOMAM Troponin C, isoform 1 OS=Homarus americanus PE=1 SV=1 3 146 2.0E-32
sp|Q9CQ19|MYL9_MOUSE Myosin regulatory light polypeptide 9 OS=Mus musculus GN=Myl9 PE=1 SV=3 7 146 5.0E-32
sp|Q9BLG0|TNNC_TODPA Troponin C OS=Todarodes pacificus PE=1 SV=3 1 147 6.0E-32
sp|Q94726|CATR4_PARTE Caltractin ICL1d OS=Paramecium tetraurelia GN=Icl1d PE=3 SV=1 5 149 1.0E-31
sp|Q27178|CATR3_PARTE Caltractin ICL1c OS=Paramecium tetraurelia GN=Icl1c PE=3 SV=1 5 149 1.0E-31
sp|Q27179|CATR2_PARTE Caltractin ICL1b OS=Paramecium tetraurelia GN=Icl1b PE=3 SV=2 5 149 1.0E-31
sp|Q9M8U1|CML18_ARATH Probable calcium-binding protein CML18 OS=Arabidopsis thaliana GN=CML18 PE=1 SV=1 5 146 1.0E-31
sp|Q6L5F4|CML14_ORYSJ Probable calcium-binding protein CML14 OS=Oryza sativa subsp. japonica GN=CML14 PE=2 SV=1 5 146 2.0E-31
sp|Q27177|CATR1_PARTE Caltractin ICL1a OS=Paramecium tetraurelia GN=Icl1a PE=1 SV=2 5 149 2.0E-31
sp|Q9FZ75|CML15_ARATH Probable calcium-binding protein CML15 OS=Arabidopsis thaliana GN=CML15 PE=2 SV=1 7 148 2.0E-31
sp|Q5XGC7|CALL4_XENTR Calmodulin-like protein 4 OS=Xenopus tropicalis GN=calml4 PE=2 SV=1 1 144 3.0E-31
sp|Q5RBA4|MYL9_PONAB Myosin regulatory light polypeptide 9 OS=Pongo abelii GN=MYL9 PE=2 SV=3 7 146 3.0E-31
sp|P29269|MYL9_PIG Myosin regulatory light polypeptide 9 OS=Sus scrofa GN=MYL9 PE=1 SV=2 7 146 3.0E-31
sp|P24844|MYL9_HUMAN Myosin regulatory light polypeptide 9 OS=Homo sapiens GN=MYL9 PE=1 SV=4 7 146 3.0E-31
sp|P02606|MLEC_CHICK Myosin light chain 1, cardiac muscle OS=Gallus gallus PE=1 SV=3 5 147 4.0E-31
sp|P16409|MYL3_RAT Myosin light chain 3 OS=Rattus norvegicus GN=Myl3 PE=1 SV=2 5 147 5.0E-31
sp|O64943|POLC2_JUNOX Polcalcin Jun o 2 OS=Juniperus oxycedrus PE=1 SV=2 5 146 7.0E-31
sp|P02612|MLRM_CHICK Myosin regulatory light chain 2, smooth muscle major isoform OS=Gallus gallus PE=1 SV=2 7 146 8.0E-31
sp|P09542|MYL3_MOUSE Myosin light chain 3 OS=Mus musculus GN=Myl3 PE=1 SV=4 5 147 9.0E-31
sp|P24032|MLRN_CHICK Myosin regulatory light chain 2, smooth muscle minor isoform OS=Gallus gallus PE=2 SV=2 7 146 1.0E-30
sp|Q5ZCK5|CML16_ORYSJ Probable calcium-binding protein CML16 OS=Oryza sativa subsp. japonica GN=CML16 PE=2 SV=1 11 148 1.0E-30
sp|P85100|MYL3_BOVIN Myosin light chain 3 OS=Bos taurus GN=MYL3 PE=1 SV=1 5 147 2.0E-30
sp|P14649|MYL6B_HUMAN Myosin light chain 6B OS=Homo sapiens GN=MYL6B PE=1 SV=1 7 147 3.0E-30
sp|Q9FYK2|CML25_ARATH Probable calcium-binding protein CML25 OS=Arabidopsis thaliana GN=CML25 PE=2 SV=1 9 147 3.0E-30
sp|A4IF97|ML12B_BOVIN Myosin regulatory light chain 12B OS=Bos taurus GN=MYL12B PE=2 SV=1 7 146 4.0E-30
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 1 149 6.0E-30
sp|Q9LI84|CML16_ARATH Probable calcium-binding protein CML16 OS=Arabidopsis thaliana GN=CML16 PE=2 SV=2 1 146 6.0E-30
sp|Q3THE2|ML12B_MOUSE Myosin regulatory light chain 12B OS=Mus musculus GN=Myl12b PE=1 SV=2 7 146 9.0E-30
sp|O14950|ML12B_HUMAN Myosin regulatory light chain 12B OS=Homo sapiens GN=MYL12B PE=1 SV=2 7 146 9.0E-30
sp|Q64122|MYL9_RAT Myosin regulatory light polypeptide 9 OS=Rattus norvegicus GN=Myl9 PE=1 SV=2 7 146 1.0E-29
sp|P18666|ML12B_RAT Myosin regulatory light chain 12B OS=Rattus norvegicus GN=Myl12b PE=1 SV=3 7 146 1.0E-29
sp|Q5R887|MYL3_PONAB Myosin light chain 3 OS=Pongo abelii GN=MYL3 PE=2 SV=3 5 147 1.0E-29
sp|P08590|MYL3_HUMAN Myosin light chain 3 OS=Homo sapiens GN=MYL3 PE=1 SV=3 5 147 1.0E-29
sp|Q9JLK7|CABP1_MOUSE Calcium-binding protein 1 OS=Mus musculus GN=Cabp1 PE=1 SV=3 4 146 2.0E-29
sp|Q9N1R0|CABP1_BOVIN Calcium-binding protein 1 OS=Bos taurus GN=CABP1 PE=1 SV=3 4 146 2.0E-29
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 1 149 2.0E-29
sp|Q5E9E2|MYL9_BOVIN Myosin regulatory light polypeptide 9 OS=Bos taurus GN=MYL9 PE=2 SV=3 7 146 2.0E-29
sp|Q5RC34|ML12A_PONAB Myosin regulatory light chain 12A OS=Pongo abelii GN=MYL12A PE=2 SV=3 7 146 3.0E-29
sp|P19105|ML12A_HUMAN Myosin regulatory light chain 12A OS=Homo sapiens GN=MYL12A PE=1 SV=2 7 146 3.0E-29
sp|P35622|TNNC_MIZYE Troponin C OS=Mizuhopecten yessoensis PE=1 SV=1 6 147 4.0E-29
sp|P57796|CABP4_HUMAN Calcium-binding protein 4 OS=Homo sapiens GN=CABP4 PE=1 SV=2 5 146 5.0E-29
sp|Q8RZB5|CML10_ORYSJ Probable calcium-binding protein CML10 OS=Oryza sativa subsp. japonica GN=CML10 PE=2 SV=1 12 146 6.0E-29
sp|P13833|MLR_DICDI Myosin regulatory light chain OS=Dictyostelium discoideum GN=mlcR PE=2 SV=1 5 149 6.0E-29
sp|Q9NP86|CABP5_HUMAN Calcium-binding protein 5 OS=Homo sapiens GN=CABP5 PE=1 SV=1 4 146 6.0E-29
sp|O88751|CABP1_RAT Calcium-binding protein 1 OS=Rattus norvegicus GN=Cabp1 PE=1 SV=2 4 146 1.0E-28
sp|Q9JLK3|CABP5_MOUSE Calcium-binding protein 5 OS=Mus musculus GN=Cabp5 PE=1 SV=1 4 146 1.0E-28
sp|P21798|TNNC2_BALNU Troponin C, isoform 2 OS=Balanus nubilus PE=1 SV=2 1 146 1.0E-28
sp|Q8HZJ4|CABP4_BOVIN Calcium-binding protein 4 OS=Bos taurus GN=CABP4 PE=2 SV=1 5 146 1.0E-28
sp|P02605|MLE3_CHICK Myosin light chain 3, skeletal muscle isoform OS=Gallus gallus PE=1 SV=3 4 147 1.0E-28
sp|P47949|TNNC3_DROME Troponin C, isoform 3 OS=Drosophila melanogaster GN=TpnC73F PE=2 SV=2 5 146 1.0E-28
sp|Q9LNE7|CML7_ARATH Calmodulin-like protein 7 OS=Arabidopsis thaliana GN=CML7 PE=2 SV=1 11 146 1.0E-28
sp|P05976|MYL1_HUMAN Myosin light chain 1/3, skeletal muscle isoform OS=Homo sapiens GN=MYL1 PE=2 SV=3 5 147 2.0E-28
sp|P13832|MRLCA_RAT Myosin regulatory light chain RLC-A OS=Rattus norvegicus GN=Rlc-a PE=2 SV=2 7 146 2.0E-28
sp|O22845|CML5_ARATH Calmodulin-like protein 5 OS=Arabidopsis thaliana GN=CML5 PE=2 SV=2 11 146 2.0E-28
sp|Q9N1Q9|CABP2_BOVIN Calcium-binding protein 2 OS=Bos taurus GN=CABP2 PE=2 SV=3 5 146 2.0E-28
sp|P15845|SM20_SCHMA 20 kDa calcium-binding protein OS=Schistosoma mansoni GN=SM20 PE=2 SV=2 4 146 2.0E-28
sp|P06704|CDC31_YEAST Cell division control protein 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC31 PE=1 SV=2 5 145 3.0E-28
sp|Q8CI43|MYL6B_MOUSE Myosin light chain 6B OS=Mus musculus GN=Myl6b PE=1 SV=1 7 147 3.0E-28
sp|Q9NZU7|CABP1_HUMAN Calcium-binding protein 1 OS=Homo sapiens GN=CABP1 PE=1 SV=5 4 146 3.0E-28
sp|P02600|MYL1_RAT Myosin light chain 1/3, skeletal muscle isoform OS=Rattus norvegicus GN=Myl1 PE=1 SV=2 5 147 3.0E-28
sp|Q9M7R0|ALL8_OLEEU Calcium-binding allergen Ole e 8 OS=Olea europaea PE=1 SV=1 4 149 4.0E-28
sp|Q9LE22|CML27_ARATH Probable calcium-binding protein CML27 OS=Arabidopsis thaliana GN=CML27 PE=1 SV=1 12 146 4.0E-28
sp|P08053|MLR_PHYPO Myosin regulatory light chain OS=Physarum polycephalum PE=1 SV=1 12 147 4.0E-28
sp|P02602|MYL1_RABIT Myosin light chain 1/3, skeletal muscle isoform OS=Oryctolagus cuniculus GN=MYL1 PE=1 SV=3 5 147 6.0E-28
sp|P29291|TNNCB_HOMAM Troponin C, isoform 2B OS=Homarus americanus PE=1 SV=1 3 146 8.0E-28
sp|Q9N1Q8|CABP5_BOVIN Calcium-binding protein 5 OS=Bos taurus GN=CABP5 PE=1 SV=1 4 146 8.0E-28
sp|P02604|MLE1_CHICK Myosin light chain 1, skeletal muscle isoform OS=Gallus gallus PE=1 SV=3 5 147 9.0E-28
sp|P09540|MLEX_CHICK Myosin light chain, embryonic OS=Gallus gallus PE=2 SV=1 8 147 9.0E-28
sp|Q24956|CATR_GIAIN Caltractin OS=Giardia intestinalis GN=CAL PE=3 SV=1 5 146 9.0E-28
sp|P17209|MYL4_RAT Myosin light chain 4 OS=Rattus norvegicus GN=Myl4 PE=2 SV=2 5 147 1.0E-27
sp|P12829|MYL4_HUMAN Myosin light chain 4 OS=Homo sapiens GN=MYL4 PE=1 SV=3 5 147 1.0E-27
sp|P47948|TNNC2_DROME Troponin C, isoform 2 OS=Drosophila melanogaster GN=TpnC47D PE=2 SV=2 5 146 1.0E-27
sp|Q9NPB3|CABP2_HUMAN Calcium-binding protein 2 OS=Homo sapiens GN=CABP2 PE=1 SV=4 5 146 1.0E-27
sp|P05977|MYL1_MOUSE Myosin light chain 1/3, skeletal muscle isoform OS=Mus musculus GN=Myl1 PE=1 SV=2 5 147 2.0E-27
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 1 146 2.0E-27
sp|Q09196|MLR4_SCHPO Myosin regulatory light chain cdc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc4 PE=1 SV=1 11 147 2.0E-27
sp|P06707|TNNC1_ASTLP Troponin C, isotype alpha OS=Astacus leptodactylus PE=1 SV=1 3 146 3.0E-27
sp|A0JNJ5|MYL1_BOVIN Myosin light chain 1/3, skeletal muscle isoform OS=Bos taurus GN=MYL1 PE=2 SV=1 5 147 3.0E-27
sp|Q9JLK4|CABP2_MOUSE Calcium-binding protein 2 OS=Mus musculus GN=Cabp2 PE=2 SV=3 5 146 3.0E-27
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 1 149 4.0E-27
sp|P29290|TNNCA_HOMAM Troponin C, isoform 2A OS=Homarus americanus PE=1 SV=1 3 146 4.0E-27
sp|Q9ZR02|CML6_ARATH Calmodulin-like protein 6 OS=Arabidopsis thaliana GN=CML6 PE=2 SV=1 11 146 4.0E-27
sp|Q9LX27|CML4_ARATH Calmodulin-like protein 4 OS=Arabidopsis thaliana GN=CML4 PE=2 SV=1 8 146 4.0E-27
sp|P09541|MYL4_MOUSE Myosin light chain 4 OS=Mus musculus GN=Myl4 PE=1 SV=3 5 147 5.0E-27
sp|P40423|SQH_DROME Myosin regulatory light chain sqh OS=Drosophila melanogaster GN=sqh PE=1 SV=1 7 146 5.0E-27
sp|Q0DJV6|CML18_ORYSJ Probable calcium-binding protein CML18 OS=Oryza sativa subsp. japonica GN=CML18 PE=2 SV=1 10 142 6.0E-27
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 1 146 7.0E-27
sp|P07462|MLE_HALRO Myosin catalytic light chain, smooth muscle OS=Halocynthia roretzi PE=1 SV=1 5 148 9.0E-27
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 1 149 1.0E-26
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 1 149 1.0E-26
sp|Q9C8Y1|CML23_ARATH Probable calcium-binding protein CML23 OS=Arabidopsis thaliana GN=CML23 PE=2 SV=1 12 147 2.0E-26
sp|O35648|CETN3_MOUSE Centrin-3 OS=Mus musculus GN=Cetn3 PE=1 SV=1 5 146 2.0E-26
sp|Q9C9U8|CML26_ARATH Probable calcium-binding protein CML26 OS=Arabidopsis thaliana GN=CML26 PE=1 SV=1 12 146 3.0E-26
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 1 146 3.0E-26
sp|O15182|CETN3_HUMAN Centrin-3 OS=Homo sapiens GN=CETN3 PE=1 SV=2 5 146 3.0E-26
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 1 146 3.0E-26
sp|Q09510|MLRH_CAEEL Myosin regulatory light chain OS=Caenorhabditis elegans GN=mlc-4 PE=1 SV=1 7 146 3.0E-26
sp|Q8VHC5|CABP4_MOUSE Calcium-binding protein 4 OS=Mus musculus GN=Cabp4 PE=1 SV=1 16 146 4.0E-26
sp|P21788|SP15_HEMPU 15 kDa calcium-binding protein OS=Hemicentrotus pulcherrimus PE=1 SV=1 5 146 4.0E-26
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 1 146 4.0E-26
sp|P21797|TNNC1_BALNU Troponin C, isoform 1 OS=Balanus nubilus PE=1 SV=1 5 146 9.0E-26
sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 1 149 9.0E-26
sp|P06708|TNNC2_ASTLP Troponin C, isotype gamma OS=Astacus leptodactylus PE=1 SV=1 3 146 1.0E-25
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 1 149 1.0E-25
sp|O74435|CDC31_SCHPO Cell division control protein 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc31 PE=1 SV=1 5 147 1.0E-25
sp|P48593|E631_DROME Calcium-binding protein E63-1 OS=Drosophila melanogaster GN=Eip63F-1 PE=2 SV=2 6 147 1.0E-25
sp|Q0DZP5|CML17_ORYSJ Probable calcium-binding protein CML17 OS=Oryza sativa subsp. japonica GN=CML17 PE=2 SV=1 5 146 2.0E-25
sp|Q17133|MLE_BRAFL Myosin, essential light chain OS=Branchiostoma floridae PE=2 SV=1 5 147 2.0E-25
sp|P82159|MLE1_LIZRA Myosin light chain 1, skeletal muscle isoform OS=Liza ramada PE=1 SV=1 5 147 7.0E-25
sp|P82160|MLE3_LIZRA Myosin light chain 3, skeletal muscle isoform OS=Liza ramada PE=1 SV=1 5 147 7.0E-25
sp|Q9XVI9|MLC5_CAEEL Myosin-2 essential light chain OS=Caenorhabditis elegans GN=mlc-5 PE=1 SV=1 10 147 7.0E-25
sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 1 146 8.0E-25
sp|Q2QVI1|CML28_ORYSJ Probable calcium-binding protein CML28 OS=Oryza sativa subsp. japonica GN=CML28 PE=2 SV=1 11 146 8.0E-25
sp|P08051|MLR_SPISA Myosin regulatory light chain, smooth muscle OS=Spisula sachalinensis PE=1 SV=1 5 143 2.0E-24
sp|P25070|CML24_ARATH Calcium-binding protein CML24 OS=Arabidopsis thaliana GN=CML24 PE=2 SV=2 12 146 2.0E-24
sp|P25071|CML12_ARATH Calmodulin-like protein 12 OS=Arabidopsis thaliana GN=CML12 PE=1 SV=3 5 85 5.0E-24
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 1 146 6.0E-24
sp|P04109|SPE1A_STRPU Calcium-binding protein SPEC 1A OS=Strongylocentrotus purpuratus GN=SPEC1 PE=2 SV=3 5 146 6.0E-24
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 1 146 8.0E-24
sp|Q11083|YT67_CAEEL Uncharacterized calcium-binding protein B0563.7 OS=Caenorhabditis elegans GN=B0563.7 PE=3 SV=1 5 146 9.0E-24
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 1 146 1.0E-23
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 1 146 2.0E-23
sp|P53141|MLC1_YEAST Myosin light chain 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLC1 PE=1 SV=1 14 149 2.0E-23
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 1 143 3.0E-23
sp|Q6L4D4|CML15_ORYSJ Probable calcium-binding protein CML15 OS=Oryza sativa subsp. japonica GN=CML15 PE=2 SV=1 12 147 3.0E-23
sp|Q0JC44|CML22_ORYSJ Probable calcium-binding protein CML22 OS=Oryza sativa subsp. japonica GN=CML22 PE=3 SV=1 10 146 3.0E-23
sp|Q9ZQE6|CML1_ARATH Calmodulin-like protein 1 OS=Arabidopsis thaliana GN=CML1 PE=2 SV=1 5 146 4.0E-23
sp|P07290|MLE_MIZYE Myosin, essential light chain, adductor muscle OS=Mizuhopecten yessoensis PE=1 SV=1 5 147 2.0E-22
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 1 146 3.0E-22
sp|Q7M2V4|MLRV_RABIT Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Oryctolagus cuniculus GN=MYL2 PE=1 SV=2 9 148 3.0E-22
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 1 146 3.0E-22
sp|Q9SS31|CML36_ARATH Probable calcium-binding protein CML36 OS=Arabidopsis thaliana GN=CML36 PE=2 SV=1 12 146 4.0E-22
sp|P07291|MLE_ARGIR Myosin essential light chain, striated adductor muscle OS=Argopecten irradians PE=1 SV=2 5 147 5.0E-22
sp|P10916|MLRV_HUMAN Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Homo sapiens GN=MYL2 PE=1 SV=3 9 148 9.0E-22
sp|P80164|MLR_LUMTE Myosin regulatory light chain, striated muscle, 25 kDa isoform OS=Lumbricus terrestris PE=1 SV=1 5 146 1.0E-21
sp|Q9SU00|CML2_ARATH Calmodulin-like protein 2 OS=Arabidopsis thaliana GN=CML2 PE=2 SV=1 11 146 1.0E-21
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 1 146 2.0E-21
sp|P51667|MLRV_MOUSE Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Mus musculus GN=Myl2 PE=1 SV=3 9 148 3.0E-21
sp|P08733|MLRV_RAT Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Rattus norvegicus GN=Myl2 PE=1 SV=2 9 148 3.0E-21
sp|Q9FIH9|CML37_ARATH Calcium-binding protein CML37 OS=Arabidopsis thaliana GN=CML37 PE=2 SV=1 10 146 5.0E-21
sp|Q1HPS0|MLR_BOMMO Myosin regulatory light chain 2 OS=Bombyx mori PE=1 SV=1 5 146 5.0E-21
sp|Q9SSF8|CDPKU_ARATH Calcium-dependent protein kinase 30 OS=Arabidopsis thaliana GN=CPK30 PE=1 SV=1 1 146 5.0E-21
sp|Q8L3R2|CML41_ARATH Probable calcium-binding protein CML41 OS=Arabidopsis thaliana GN=CML41 PE=2 SV=2 12 146 5.0E-21
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 1 146 6.0E-21
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 1 146 7.0E-21
sp|P04110|SPE2A_STRPU Calcium-binding protein SPEC 2A OS=Strongylocentrotus purpuratus GN=SPEC2A PE=2 SV=2 5 146 7.0E-21
sp|Q9S9V0|CDPKV_ARATH Calcium-dependent protein kinase 31 OS=Arabidopsis thaliana GN=CPK31 PE=2 SV=2 1 146 9.0E-21
sp|Q9SRR7|CML3_ARATH Calmodulin-like protein 3 OS=Arabidopsis thaliana GN=CML3 PE=2 SV=1 11 146 1.0E-20
sp|Q9CQ46|EFCB2_MOUSE EF-hand calcium-binding domain-containing protein 2 OS=Mus musculus GN=Efcab2 PE=1 SV=1 3 147 3.0E-20
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 1 146 4.0E-20
sp|Q3SZE5|MLRV_BOVIN Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Bos taurus GN=MYL2 PE=1 SV=1 9 148 6.0E-20
sp|Q6BWS8|CANB_DEBHA Calcineurin subunit B OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CNB1 PE=3 SV=1 7 142 7.0E-20
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 1 146 8.0E-20
sp|Q8RYJ8|CML19_ORYSJ Putative calcium-binding protein CML19 OS=Oryza sativa subsp. japonica GN=CML19 PE=3 SV=1 11 146 9.0E-20
sp|Q62082|MYL10_MOUSE Myosin regulatory light chain 10 OS=Mus musculus GN=Myl10 PE=2 SV=1 7 148 1.0E-19
sp|P08052|MLR_TODPA Myosin regulatory light chain LC-2, mantle muscle OS=Todarodes pacificus PE=1 SV=1 5 145 1.0E-19
sp|Q8W4I7|CDPKD_ARATH Calcium-dependent protein kinase 13 OS=Arabidopsis thaliana GN=CPK13 PE=1 SV=2 1 146 1.0E-19
sp|Q39584|DYL3_CHLRE Dynein 18 kDa light chain, flagellar outer arm OS=Chlamydomonas reinhardtii PE=1 SV=1 4 146 1.0E-19
sp|P02611|MLRB_CHICK Myosin regulatory light chain 2B, cardiac muscle isoform OS=Gallus gallus PE=1 SV=2 9 146 2.0E-19
sp|P09402|MLE_DICDI Myosin, essential light chain OS=Dictyostelium discoideum GN=mlcE PE=2 SV=2 12 147 2.0E-19
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 1 146 2.0E-19
sp|P07461|MLR_HALRO Myosin regulatory light chain, smooth muscle OS=Halocynthia roretzi PE=1 SV=1 7 146 2.0E-19
sp|Q02045|MYL5_HUMAN Myosin light chain 5 OS=Homo sapiens GN=MYL5 PE=2 SV=1 9 139 3.0E-19
sp|P41691|MYL5_FELCA Myosin light chain 5 OS=Felis catus GN=MYL5 PE=2 SV=2 7 146 4.0E-19
sp|P30188|CML35_ARATH Probable calcium-binding protein CML35 OS=Arabidopsis thaliana GN=CML35 PE=2 SV=2 11 147 4.0E-19
sp|Q9M101|CDPKN_ARATH Calcium-dependent protein kinase 23 OS=Arabidopsis thaliana GN=CPK23 PE=1 SV=1 2 146 5.0E-19
sp|P53014|MLE_CAEEL Myosin, essential light chain OS=Caenorhabditis elegans GN=mlc-3 PE=3 SV=1 13 147 5.0E-19
sp|P05095|ACTNA_DICDI Alpha-actinin A OS=Dictyostelium discoideum GN=abpA PE=1 SV=2 5 148 6.0E-19
sp|P04111|SPE2C_STRPU Calcium-binding protein SPEC 2C OS=Strongylocentrotus purpuratus GN=SPEC2C PE=2 SV=2 5 146 8.0E-19
sp|P02610|MLRA_CHICK Myosin regulatory light chain 2A, cardiac muscle isoform OS=Gallus gallus PE=1 SV=2 7 146 1.0E-18
sp|Q9M9V8|CDPKA_ARATH Calcium-dependent protein kinase 10 OS=Arabidopsis thaliana GN=CPK10 PE=1 SV=1 1 146 1.0E-18
sp|P05963|MLR_CHLNI Myosin regulatory light chain, striated adductor muscle OS=Chlamys nipponensis akazara PE=1 SV=1 5 146 2.0E-18
sp|Q3SEK0|CATR5_PARTE Caltractin ICL1e OS=Paramecium tetraurelia GN=Icl1e PE=3 SV=1 5 149 3.0E-18
sp|Q9LF55|CML32_ARATH Probable calcium-binding protein CML32 OS=Arabidopsis thaliana GN=CML32 PE=2 SV=1 15 146 3.0E-18
sp|Q10LX4|CML27_ORYSJ Probable calcium-binding protein CML27 OS=Oryza sativa subsp. japonica GN=CML27 PE=2 SV=1 13 148 3.0E-18
sp|P13543|MLR_ARGIR Myosin regulatory light chain, striated adductor muscle OS=Argopecten irradians PE=1 SV=3 5 146 3.0E-18
sp|Q9ZSA3|CDPKM_ARATH Calcium-dependent protein kinase 22 OS=Arabidopsis thaliana GN=CPK22 PE=3 SV=2 1 146 3.0E-18
sp|Q01449|MLRA_HUMAN Myosin regulatory light chain 2, atrial isoform OS=Homo sapiens GN=MYL7 PE=1 SV=1 7 146 4.0E-18
sp|Q9UUG5|MLR1_SCHPO Myosin regulatory light chain 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rlc1 PE=1 SV=1 5 143 4.0E-18
sp|P53684|CDPKB_ORYSJ Calcium-dependent protein kinase isoform 11 OS=Oryza sativa subsp. japonica GN=CPK11 PE=2 SV=2 1 146 4.0E-18
sp|Q9QVP4|MLRA_MOUSE Myosin regulatory light chain 2, atrial isoform OS=Mus musculus GN=Myl7 PE=1 SV=1 7 146 6.0E-18
sp|P05944|MLRC_MIZYE Myosin regulatory light chain, striated adductor muscle OS=Mizuhopecten yessoensis PE=1 SV=1 5 146 8.0E-18
sp|P04112|MLRB_MIZYE Myosin regulatory light chain B, smooth adductor muscle OS=Mizuhopecten yessoensis PE=1 SV=1 5 146 8.0E-18
sp|P63100|CANB1_RAT Calcineurin subunit B type 1 OS=Rattus norvegicus GN=Ppp3r1 PE=1 SV=2 1 146 1.0E-17
sp|Q63810|CANB1_MOUSE Calcineurin subunit B type 1 OS=Mus musculus GN=Ppp3r1 PE=1 SV=3 1 146 1.0E-17
sp|P63098|CANB1_HUMAN Calcineurin subunit B type 1 OS=Homo sapiens GN=PPP3R1 PE=1 SV=2 1 146 1.0E-17
sp|P63099|CANB1_BOVIN Calcineurin subunit B type 1 OS=Bos taurus GN=PPP3R1 PE=1 SV=2 1 146 1.0E-17
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 1 146 1.0E-17
sp|P0CM54|CANB_CRYNJ Calcineurin subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNB1 PE=2 SV=1 4 146 2.0E-17
sp|P0CM55|CANB_CRYNB Calcineurin subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNB1 PE=3 SV=1 4 146 2.0E-17
sp|Q54X77|CETNB_DICDI Centrin-B OS=Dictyostelium discoideum GN=cenB PE=3 SV=1 2 149 2.0E-17
sp|P15844|SPE2D_STRPU Calcium-binding protein SPEC 2D OS=Strongylocentrotus purpuratus GN=SPEC2D PE=2 SV=1 5 147 2.0E-17
sp|P09485|LPS1A_LYTPI Calcium-binding protein LPS1-alpha OS=Lytechinus pictus PE=2 SV=2 1 143 3.0E-17
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 6 148 4.0E-17
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 6 148 4.0E-17
sp|Q7XHW4|CML24_ORYSJ Probable calcium-binding protein CML24 OS=Oryza sativa subsp. japonica GN=CML24 PE=2 SV=1 13 148 4.0E-17
sp|Q63811|CANB2_MOUSE Calcineurin subunit B type 2 OS=Mus musculus GN=Ppp3r2 PE=1 SV=3 1 142 5.0E-17
sp|P02609|MLRS_CHICK Myosin regulatory light chain 2, skeletal muscle isoform OS=Gallus gallus GN=MYLPF PE=1 SV=2 7 148 5.0E-17
sp|P42322|CANB1_NAEGR Calcineurin subunit B OS=Naegleria gruberi GN=CNB1 PE=3 SV=1 4 146 1.0E-16
sp|O01305|CAVP_BRAFL Calcium vector protein OS=Branchiostoma floridae PE=2 SV=3 2 146 1.0E-16
sp|P05945|MLE_TODPA Myosin catalytic light chain LC-1, mantle muscle OS=Todarodes pacificus PE=1 SV=2 5 147 1.0E-16
sp|P04573|CAVP_BRALA Calcium vector protein OS=Branchiostoma lanceolatum PE=1 SV=3 2 146 1.0E-16
sp|Q66H96|CABP7_RAT Calcium-binding protein 7 OS=Rattus norvegicus GN=Cabp7 PE=1 SV=1 5 87 1.0E-16
sp|Q866X0|CABP7_PAPAN Calcium-binding protein 7 OS=Papio anubis GN=CABP7 PE=3 SV=1 5 87 1.0E-16
sp|Q91ZM8|CABP7_MOUSE Calcium-binding protein 7 OS=Mus musculus GN=Cabp7 PE=2 SV=1 5 87 1.0E-16
sp|Q86V35|CABP7_HUMAN Calcium-binding protein 7 OS=Homo sapiens GN=CABP7 PE=1 SV=1 5 87 1.0E-16
sp|P19626|MLR2_CAEEL Myosin regulatory light chain 2 OS=Caenorhabditis elegans GN=mlc-2 PE=3 SV=1 2 146 2.0E-16
sp|P19625|MLR1_CAEEL Myosin regulatory light chain 1 OS=Caenorhabditis elegans GN=mlc-1 PE=3 SV=1 2 146 2.0E-16
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 1 146 2.0E-16
sp|P02613|MLR_PATSP Myosin regulatory light chain OS=Patinopecten sp. PE=1 SV=1 5 146 2.0E-16
sp|P04113|MLRA_MIZYE Myosin regulatory light chain A, smooth adductor muscle OS=Mizuhopecten yessoensis PE=1 SV=1 5 146 3.0E-16
sp|Q9SRP4|CML33_ARATH Probable calcium-binding protein CML33 OS=Arabidopsis thaliana GN=CML33 PE=2 SV=1 17 139 3.0E-16
sp|Q9BUA6|MYL10_HUMAN Myosin regulatory light chain 10 OS=Homo sapiens GN=MYL10 PE=2 SV=2 15 146 3.0E-16
sp|Q757B7|CANB_ASHGO Calcineurin subunit B OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CNB1 PE=3 SV=1 8 142 4.0E-16
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 6 148 4.0E-16
sp|P28470|CANB2_RAT Calcineurin subunit B type 2 OS=Rattus norvegicus GN=Ppp3r2 PE=2 SV=2 1 142 5.0E-16
sp|Q9SJN6|CML31_ARATH Probable calcium-binding protein CML31 OS=Arabidopsis thaliana GN=CML31 PE=2 SV=2 15 147 8.0E-16
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 1 146 8.0E-16
sp|Q9SVG9|CML42_ARATH Calcium-binding protein CML42 OS=Arabidopsis thaliana GN=CML42 PE=1 SV=1 17 146 1.0E-15
sp|Q24214|CANB2_DROME Calcineurin subunit B type 2 OS=Drosophila melanogaster GN=CanB2 PE=1 SV=2 1 146 1.0E-15
sp|Q6CGE6|CANB_YARLI Calcineurin subunit B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CNB1 PE=3 SV=1 4 142 1.0E-15
sp|Q9BXU9|CABP8_HUMAN Calcium-binding protein 8 OS=Homo sapiens GN=CALN1 PE=2 SV=1 4 110 1.0E-15
sp|P18432|MLR_DROME Myosin regulatory light chain 2 OS=Drosophila melanogaster GN=Mlc2 PE=1 SV=2 5 149 1.0E-15
sp|Q9SRP5|CML34_ARATH Probable calcium-binding protein CML34 OS=Arabidopsis thaliana GN=CML34 PE=1 SV=1 14 147 1.0E-15
sp|P48451|CANB1_DROME Calcineurin subunit B type 1 OS=Drosophila melanogaster GN=CanB PE=2 SV=1 1 146 2.0E-15
sp|Q0DJ94|CML21_ORYSJ Probable calcium-binding protein CML21 OS=Oryza sativa subsp. japonica GN=CML21 PE=2 SV=2 13 146 2.0E-15
sp|Q84UL5|CML32_ORYSJ Probable calcium-binding protein CML32 OS=Oryza sativa subsp. japonica GN=CML32 PE=2 SV=1 12 146 2.0E-15
sp|Q9NJU9|CDPK3_PLAF7 Calcium-dependent protein kinase 3 OS=Plasmodium falciparum (isolate 3D7) GN=CPK3 PE=1 SV=1 1 149 2.0E-15
sp|Q96A32|MLRS_HUMAN Myosin regulatory light chain 2, skeletal muscle isoform OS=Homo sapiens GN=MYLPF PE=2 SV=1 7 148 2.0E-15
sp|Q06BI3|CABP8_RAT Calcium-binding protein 8 OS=Rattus norvegicus GN=Caln1 PE=1 SV=1 4 110 2.0E-15
sp|Q9JJG7|CABP8_MOUSE Calcium-binding protein 8 OS=Mus musculus GN=Caln1 PE=2 SV=1 4 110 2.0E-15
sp|P04466|MLRS_RAT Myosin regulatory light chain 2, skeletal muscle isoform OS=Rattus norvegicus GN=Mylpf PE=1 SV=2 7 148 2.0E-15
sp|P02608|MLRS_RABIT Myosin regulatory light chain 2, skeletal muscle isoform type 2 OS=Oryctolagus cuniculus GN=MYLPF PE=1 SV=3 7 148 2.0E-15
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 1 146 2.0E-15
sp|P25296|CANB_YEAST Calcineurin subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNB1 PE=1 SV=3 8 142 3.0E-15
sp|P97457|MLRS_MOUSE Myosin regulatory light chain 2, skeletal muscle isoform OS=Mus musculus GN=Mylpf PE=1 SV=3 7 148 3.0E-15
sp|Q2TBI5|CANB2_BOVIN Calcineurin subunit B type 2 OS=Bos taurus GN=PPP3R2 PE=2 SV=3 1 142 3.0E-15
sp|Q9FI19|CML43_ARATH Probable calcium-binding protein CML43 OS=Arabidopsis thaliana GN=CML43 PE=2 SV=1 16 146 3.0E-15
sp|Q66H96|CABP7_RAT Calcium-binding protein 7 OS=Rattus norvegicus GN=Cabp7 PE=1 SV=1 81 149 5.0E-15
sp|Q866X0|CABP7_PAPAN Calcium-binding protein 7 OS=Papio anubis GN=CABP7 PE=3 SV=1 81 149 5.0E-15
sp|Q91ZM8|CABP7_MOUSE Calcium-binding protein 7 OS=Mus musculus GN=Cabp7 PE=2 SV=1 81 149 5.0E-15
sp|Q86V35|CABP7_HUMAN Calcium-binding protein 7 OS=Homo sapiens GN=CABP7 PE=1 SV=1 81 149 5.0E-15
sp|Q54IY3|CETNA_DICDI Centrin-A OS=Dictyostelium discoideum GN=cenA PE=3 SV=1 5 149 5.0E-15
sp|Q8RYK0|CML31_ORYSJ Probable calcium-binding protein CML31 OS=Oryza sativa subsp. japonica GN=CML31 PE=2 SV=1 11 147 6.0E-15
sp|Q55G87|CANB1_DICDI Calcineurin subunit B type 1 OS=Dictyostelium discoideum GN=cnbA PE=1 SV=1 4 146 6.0E-15
sp|Q03975|LPS1B_LYTPI Calcium-binding protein LPS1-beta (Fragment) OS=Lytechinus pictus PE=2 SV=2 4 149 6.0E-15
sp|P87072|CANB_NEUCR Calcineurin subunit B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cnb-1 PE=2 SV=2 8 146 6.0E-15
sp|P54680|FIMB_DICDI Fimbrin OS=Dictyostelium discoideum GN=fimA PE=2 SV=2 4 75 1.0E-14
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 17 142 1.0E-14
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 8 142 1.0E-14
sp|P24732|MLRT_RABIT Myosin regulatory light chain 2, skeletal muscle isoform type 1 OS=Oryctolagus cuniculus PE=2 SV=2 7 146 1.0E-14
sp|Q0P571|MLRS_BOVIN Myosin regulatory light chain 2, skeletal muscle isoform OS=Bos taurus GN=MYLPF PE=2 SV=1 7 148 1.0E-14
sp|Q09665|TNNC2_CAEEL Troponin C, isoform 2 OS=Caenorhabditis elegans GN=tnc-2 PE=2 SV=1 12 74 3.0E-14
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 6 148 3.0E-14
sp|Q9UU93|CANB_SCHPO Calcineurin subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnb1 PE=3 SV=1 4 142 3.0E-14
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 6 148 5.0E-14
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 6 148 5.0E-14
sp|Q96LZ3|CANB2_HUMAN Calcineurin subunit B type 2 OS=Homo sapiens GN=PPP3R2 PE=1 SV=3 1 142 1.0E-13
sp|P25070|CML24_ARATH Calcium-binding protein CML24 OS=Arabidopsis thaliana GN=CML24 PE=2 SV=2 10 74 2.0E-13
sp|Q5VUJ9|EFCB2_HUMAN EF-hand calcium-binding domain-containing protein 2 OS=Homo sapiens GN=EFCAB2 PE=2 SV=1 10 111 2.0E-13
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 1 146 2.0E-13
sp|Q5RCS6|ACTN4_PONAB Alpha-actinin-4 OS=Pongo abelii GN=ACTN4 PE=2 SV=1 2 142 2.0E-13
sp|P43187|ALLB3_BETPN Calcium-binding allergen Bet v 3 OS=Betula pendula GN=BETVIII PE=1 SV=1 13 146 2.0E-13
sp|O43707|ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 2 142 3.0E-13
sp|Q874T7|CANB_KLULA Calcineurin subunit B OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CNB1 PE=3 SV=1 9 142 3.0E-13
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 1 149 3.0E-13
sp|Q09011|CAST_SOLTU Calcium-binding protein CAST OS=Solanum tuberosum PE=2 SV=1 13 146 3.0E-13
sp|Q9SRE7|CML39_ARATH Calcium-binding protein CML39 OS=Arabidopsis thaliana GN=CML39 PE=2 SV=1 7 146 3.0E-13
sp|Q8RYJ9|CML23_ORYSJ Putative calcium-binding protein CML23 OS=Oryza sativa subsp. japonica GN=CML23 PE=3 SV=1 12 147 3.0E-13
sp|P09485|LPS1A_LYTPI Calcium-binding protein LPS1-alpha OS=Lytechinus pictus PE=2 SV=2 20 149 6.0E-13
sp|Q6FLU4|CANB_CANGA Calcineurin subunit B OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CNB1 PE=3 SV=1 8 142 6.0E-13
sp|P53682|CDPK1_ORYSJ Calcium-dependent protein kinase isoform 1 OS=Oryza sativa subsp. japonica GN=SPK PE=2 SV=2 1 146 6.0E-13
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 1 146 7.0E-13
sp|P09485|LPS1A_LYTPI Calcium-binding protein LPS1-alpha OS=Lytechinus pictus PE=2 SV=2 12 142 8.0E-13
sp|A5D7D1|ACTN4_BOVIN Alpha-actinin-4 OS=Bos taurus GN=ACTN4 PE=2 SV=1 2 142 8.0E-13
sp|Q24654|MLC1_DROSI Myosin light chain alkali OS=Drosophila simulans GN=Mlc1 PE=3 SV=3 1 147 9.0E-13
sp|P06742|MLC1_DROME Myosin light chain alkali OS=Drosophila melanogaster GN=Mlc1 PE=1 SV=4 1 147 9.0E-13
sp|Q9QXQ0|ACTN4_RAT Alpha-actinin-4 OS=Rattus norvegicus GN=Actn4 PE=1 SV=2 2 142 9.0E-13
sp|P57780|ACTN4_MOUSE Alpha-actinin-4 OS=Mus musculus GN=Actn4 PE=1 SV=1 2 142 9.0E-13
sp|Q9C8Y1|CML23_ARATH Probable calcium-binding protein CML23 OS=Arabidopsis thaliana GN=CML23 PE=2 SV=1 4 73 1.0E-12
sp|Q6AXQ2|EFC11_RAT EF-hand calcium-binding domain-containing protein 11 OS=Rattus norvegicus GN=Efcab11 PE=2 SV=1 2 146 1.0E-12
sp|P34368|YLJ5_CAEEL Uncharacterized calcium-binding protein C50C3.5 OS=Caenorhabditis elegans GN=C50C3.5 PE=3 SV=3 5 146 1.0E-12
sp|Q24756|MLC1_DROVI Myosin light chain alkali OS=Drosophila virilis GN=Mlc1 PE=3 SV=1 1 147 1.0E-12
sp|A8K855|EFCB7_HUMAN EF-hand calcium-binding domain-containing protein 7 OS=Homo sapiens GN=EFCAB7 PE=2 SV=1 5 147 1.0E-12
sp|Q07167|SM16_SCHMA 16 kDa calcium-binding protein OS=Schistosoma mansoni PE=2 SV=1 12 148 1.0E-12
sp|P27164|CALM3_PETHY Calmodulin-related protein OS=Petunia hybrida GN=CAM53 PE=2 SV=2 73 149 2.0E-12
sp|O82659|CML20_ARATH Probable calcium-binding protein CML20 OS=Arabidopsis thaliana GN=CML20 PE=1 SV=1 80 149 2.0E-12
sp|Q5ZCK5|CML16_ORYSJ Probable calcium-binding protein CML16 OS=Oryza sativa subsp. japonica GN=CML16 PE=2 SV=1 8 80 2.0E-12
sp|Q24621|MLC1_DROPS Myosin light chain alkali OS=Drosophila pseudoobscura pseudoobscura GN=Mlc1 PE=3 SV=1 1 147 2.0E-12
sp|P41048|EFH51_TRYCR EF-hand protein 5 variant 1 OS=Trypanosoma cruzi PE=3 SV=1 10 143 2.0E-12
sp|Q54MF3|CANB2_DICDI Calcineurin subunit B type 2 OS=Dictyostelium discoideum GN=cnbB PE=3 SV=1 5 142 2.0E-12
sp|P30644|YNE5_CAEEL Uncharacterized calcium-binding protein R08D7.5 OS=Caenorhabditis elegans GN=R08D7.5 PE=3 SV=2 32 146 2.0E-12
sp|P04352|CALM_CHLRE Calmodulin OS=Chlamydomonas reinhardtii PE=1 SV=2 85 149 3.0E-12
sp|P05934|CALM_STRPU Calmodulin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=1 12 76 3.0E-12
sp|P27164|CALM3_PETHY Calmodulin-related protein OS=Petunia hybrida GN=CAM53 PE=2 SV=2 1 99 4.0E-12
sp|P62146|CALMA_ARBPU Calmodulin-alpha (Fragment) OS=Arbacia punctulata PE=1 SV=2 77 149 4.0E-12
sp|Q7F0J0|CML13_ORYSJ Probable calcium-binding protein CML13 OS=Oryza sativa subsp. japonica GN=CML13 PE=2 SV=1 67 149 4.0E-12
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 8 142 4.0E-12
sp|Q9D0E5|EFC11_MOUSE EF-hand calcium-binding domain-containing protein 11 OS=Mus musculus GN=Efcab11 PE=2 SV=1 12 146 4.0E-12
sp|Q5SND2|CML30_ORYSJ Probable calcium-binding protein CML30 OS=Oryza sativa subsp. japonica GN=CML30 PE=2 SV=1 17 146 4.0E-12
sp|P05419|CALN_CHICK Neo-calmodulin (Fragment) OS=Gallus gallus PE=2 SV=1 85 149 5.0E-12
sp|P54680|FIMB_DICDI Fimbrin OS=Dictyostelium discoideum GN=fimA PE=2 SV=2 82 148 5.0E-12
sp|Q5Z676|CML29_ORYSJ Probable calcium-binding protein CML29 OS=Oryza sativa subsp. japonica GN=CML29 PE=2 SV=1 10 148 5.0E-12
sp|P62150|CALM_ORYLA Calmodulin-A (Fragment) OS=Oryzias latipes GN=calm1 PE=2 SV=1 85 149 6.0E-12
sp|P04352|CALM_CHLRE Calmodulin OS=Chlamydomonas reinhardtii PE=1 SV=2 12 79 6.0E-12
sp|Q8L3R2|CML41_ARATH Probable calcium-binding protein CML41 OS=Arabidopsis thaliana GN=CML41 PE=2 SV=2 82 149 6.0E-12
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 8 142 6.0E-12
sp|Q502J0|PCAT2_DANRE Lysophosphatidylcholine acyltransferase 2 OS=Danio rerio GN=lpcat2 PE=2 SV=1 26 142 6.0E-12
sp|Q6DCF6|EFCB7_XENLA EF-hand calcium-binding domain-containing protein 7 OS=Xenopus laevis GN=efcab7 PE=2 SV=1 28 143 6.0E-12
sp|P41049|EFH52_TRYCR EF-hand protein 5 variant 2 OS=Trypanosoma cruzi PE=3 SV=1 10 143 7.0E-12
sp|Q90734|ACTN4_CHICK Alpha-actinin-4 OS=Gallus gallus GN=ACTN4 PE=1 SV=1 2 142 8.0E-12
sp|P06708|TNNC2_ASTLP Troponin C, isotype gamma OS=Astacus leptodactylus PE=1 SV=1 11 74 9.0E-12
sp|P25027|EFH5_TRYBB EF-hand protein 5 OS=Trypanosoma brucei brucei PE=2 SV=1 5 149 9.0E-12
sp|Q06BI3|CABP8_RAT Calcium-binding protein 8 OS=Rattus norvegicus GN=Caln1 PE=1 SV=1 84 149 1.0E-11
sp|Q9JJG7|CABP8_MOUSE Calcium-binding protein 8 OS=Mus musculus GN=Caln1 PE=2 SV=1 84 149 1.0E-11
sp|P04630|CALL_CAEEL Calmodulin-like protein OS=Caenorhabditis elegans GN=cal-1 PE=3 SV=1 14 76 2.0E-11
sp|P41210|CATR_ATRNU Caltractin OS=Atriplex nummularia PE=2 SV=1 84 149 2.0E-11
sp|Q9BXU9|CABP8_HUMAN Calcium-binding protein 8 OS=Homo sapiens GN=CALN1 PE=2 SV=1 84 149 2.0E-11
sp|Q12798|CETN1_HUMAN Centrin-1 OS=Homo sapiens GN=CETN1 PE=1 SV=1 81 149 3.0E-11
sp|Q9LF55|CML32_ARATH Probable calcium-binding protein CML32 OS=Arabidopsis thaliana GN=CML32 PE=2 SV=1 14 74 3.0E-11
sp|Q06827|CATR_SCHDU Caltractin OS=Scherffelia dubia PE=1 SV=1 81 149 4.0E-11
sp|Q338P8|CML8_ORYSJ Probable calcium-binding protein CML8 OS=Oryza sativa subsp. japonica GN=CML8 PE=2 SV=1 84 149 6.0E-11
sp|P05434|CATR_CHLRE Caltractin OS=Chlamydomonas reinhardtii PE=1 SV=1 81 149 7.0E-11
sp|Q948R0|CML5_ORYSJ Calmodulin-like protein 5 OS=Oryza sativa subsp. japonica GN=CML5 PE=2 SV=1 85 149 8.0E-11
sp|P43646|CATR_TETST Caltractin (Fragment) OS=Tetraselmis striata PE=2 SV=1 81 149 1.0E-10
sp|Q40642|CML1_ORYSI Calmodulin-like protein 1 OS=Oryza sativa subsp. indica GN=CML1 PE=1 SV=1 12 78 2.0E-10
sp|Q8S1Y9|CML1_ORYSJ Calmodulin-like protein 1 OS=Oryza sativa subsp. japonica GN=CML1 PE=2 SV=1 12 78 2.0E-10
sp|Q0IUU4|CML2_ORYSJ Putative calmodulin-like protein 2 OS=Oryza sativa subsp. japonica GN=CML2 PE=3 SV=2 12 78 2.0E-10
sp|Q84MN0|CML4_ORYSJ Calmodulin-like protein 4 OS=Oryza sativa subsp. japonica GN=CML4 PE=2 SV=1 87 149 2.0E-10
sp|Q5ZD81|CML12_ORYSJ Probable calcium-binding protein CML12 OS=Oryza sativa subsp. japonica GN=CML12 PE=2 SV=1 11 79 2.0E-10
sp|O22845|CML5_ARATH Calmodulin-like protein 5 OS=Arabidopsis thaliana GN=CML5 PE=2 SV=2 3 73 2.0E-10
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 72 148 2.0E-10
sp|Q7DMP0|CALM2_SOLTU Calmodulin-2/4 (Fragment) OS=Solanum tuberosum GN=PCM2 PE=2 SV=1 1 76 3.0E-10
sp|P54213|CATR_DUNSA Caltractin OS=Dunaliella salina PE=2 SV=1 81 149 3.0E-10
sp|P43645|CATR_SPESI Caltractin (Fragment) OS=Spermatozopsis similis PE=2 SV=1 81 149 3.0E-10
sp|Q9R1K9|CETN2_MOUSE Centrin-2 OS=Mus musculus GN=Cetn2 PE=1 SV=1 81 149 4.0E-10
sp|P41209|CETN1_MOUSE Centrin-1 OS=Mus musculus GN=Cetn1 PE=1 SV=1 81 149 4.0E-10
sp|Q03975|LPS1B_LYTPI Calcium-binding protein LPS1-beta (Fragment) OS=Lytechinus pictus PE=2 SV=2 12 143 4.0E-10
sp|Q6L4D4|CML15_ORYSJ Probable calcium-binding protein CML15 OS=Oryza sativa subsp. japonica GN=CML15 PE=2 SV=1 12 74 5.0E-10
sp|Q9NP86|CABP5_HUMAN Calcium-binding protein 5 OS=Homo sapiens GN=CABP5 PE=1 SV=1 10 75 6.0E-10
sp|Q9JLK3|CABP5_MOUSE Calcium-binding protein 5 OS=Mus musculus GN=Cabp5 PE=1 SV=1 10 75 6.0E-10
sp|Q6L4D4|CML15_ORYSJ Probable calcium-binding protein CML15 OS=Oryza sativa subsp. japonica GN=CML15 PE=2 SV=1 83 145 7.0E-10
sp|Q5SND2|CML30_ORYSJ Probable calcium-binding protein CML30 OS=Oryza sativa subsp. japonica GN=CML30 PE=2 SV=1 12 73 7.0E-10
sp|Q9SJN6|CML31_ARATH Probable calcium-binding protein CML31 OS=Arabidopsis thaliana GN=CML31 PE=2 SV=2 6 73 8.0E-10
sp|Q41420|CALM3_SOLTU Putative calmodulin-3 (Fragment) OS=Solanum tuberosum GN=PCM3 PE=5 SV=1 12 76 1.0E-09
sp|P41208|CETN2_HUMAN Centrin-2 OS=Homo sapiens GN=CETN2 PE=1 SV=1 81 149 1.0E-09
sp|Q2TBN3|CETN2_BOVIN Centrin-2 OS=Bos taurus GN=CETN2 PE=2 SV=1 81 149 1.0E-09
sp|Q9JLK7|CABP1_MOUSE Calcium-binding protein 1 OS=Mus musculus GN=Cabp1 PE=1 SV=3 10 75 1.0E-09
sp|Q8RYJ9|CML23_ORYSJ Putative calcium-binding protein CML23 OS=Oryza sativa subsp. japonica GN=CML23 PE=3 SV=1 82 146 1.0E-09
sp|P02589|TNNC2_PELES Troponin C, skeletal muscle OS=Pelophylax esculentus PE=1 SV=1 85 149 2.0E-09
sp|P10246|TNNC2_MELGA Troponin C, skeletal muscle OS=Meleagris gallopavo GN=TNNC2 PE=1 SV=2 85 149 2.0E-09
sp|P20801|TNNC2_MOUSE Troponin C, skeletal muscle OS=Mus musculus GN=Tnnc2 PE=1 SV=2 85 149 2.0E-09
sp|P02588|TNNC2_CHICK Troponin C, skeletal muscle OS=Gallus gallus GN=TNNC2 PE=1 SV=3 85 149 2.0E-09
sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle OS=Homo sapiens GN=TNNC2 PE=1 SV=2 85 149 2.0E-09
sp|Q32LE3|CETN1_BOVIN Centrin-1 OS=Bos taurus GN=CETN1 PE=2 SV=1 81 149 2.0E-09
sp|Q9N1R0|CABP1_BOVIN Calcium-binding protein 1 OS=Bos taurus GN=CABP1 PE=1 SV=3 10 75 2.0E-09
sp|Q9N1Q8|CABP5_BOVIN Calcium-binding protein 5 OS=Bos taurus GN=CABP5 PE=1 SV=1 10 75 2.0E-09
sp|Q9ZR02|CML6_ARATH Calmodulin-like protein 6 OS=Arabidopsis thaliana GN=CML6 PE=2 SV=1 14 75 2.0E-09
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 69 148 2.0E-09
sp|Q8RYJ8|CML19_ORYSJ Putative calcium-binding protein CML19 OS=Oryza sativa subsp. japonica GN=CML19 PE=3 SV=1 85 148 2.0E-09
sp|Q2R1Z5|CML6_ORYSJ Putative calmodulin-like protein 6 OS=Oryza sativa subsp. japonica GN=CML6 PE=3 SV=1 85 149 3.0E-09
sp|P02586|TNNC2_RABIT Troponin C, skeletal muscle OS=Oryctolagus cuniculus GN=TNNC2 PE=1 SV=2 85 149 3.0E-09
sp|P02587|TNNC2_PIG Troponin C, skeletal muscle OS=Sus scrofa GN=TNNC2 PE=1 SV=2 85 149 3.0E-09
sp|P81660|TNNC2_ANGAN Troponin C, skeletal muscle OS=Anguilla anguilla PE=1 SV=1 85 149 3.0E-09
sp|Q2TBN3|CETN2_BOVIN Centrin-2 OS=Bos taurus GN=CETN2 PE=2 SV=1 12 75 3.0E-09
sp|P53441|CATR_NAEGR Caltractin OS=Naegleria gruberi GN=CTN PE=2 SV=1 84 149 3.0E-09
sp|Q8K4K1|CETN4_MOUSE Centrin-4 OS=Mus musculus GN=Cetn4 PE=1 SV=1 12 75 3.0E-09
sp|Q7F0J0|CML13_ORYSJ Probable calcium-binding protein CML13 OS=Oryza sativa subsp. japonica GN=CML13 PE=2 SV=1 12 75 3.0E-09
sp|O23184|CML19_ARATH Calcium-binding protein CML19 OS=Arabidopsis thaliana GN=CML19 PE=1 SV=1 85 149 3.0E-09
sp|Q8RZB5|CML10_ORYSJ Probable calcium-binding protein CML10 OS=Oryza sativa subsp. japonica GN=CML10 PE=2 SV=1 83 145 3.0E-09
sp|Q0IQB6|CML3_ORYSJ Calmodulin-like protein 3 OS=Oryza sativa subsp. japonica GN=CML3 PE=2 SV=1 12 78 4.0E-09
sp|P05434|CATR_CHLRE Caltractin OS=Chlamydomonas reinhardtii PE=1 SV=1 12 75 4.0E-09
sp|Q9FZ75|CML15_ARATH Probable calcium-binding protein CML15 OS=Arabidopsis thaliana GN=CML15 PE=2 SV=1 12 79 4.0E-09
sp|O23320|CML8_ARATH Calmodulin-like protein 8 OS=Arabidopsis thaliana GN=CML8 PE=2 SV=1 85 149 5.0E-09
sp|O88751|CABP1_RAT Calcium-binding protein 1 OS=Rattus norvegicus GN=Cabp1 PE=1 SV=2 10 75 5.0E-09
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 16 75 5.0E-09
sp|Q32LE3|CETN1_BOVIN Centrin-1 OS=Bos taurus GN=CETN1 PE=2 SV=1 1 75 7.0E-09
sp|Q9N1Q8|CABP5_BOVIN Calcium-binding protein 5 OS=Bos taurus GN=CABP5 PE=1 SV=1 80 149 7.0E-09
sp|Q10LX4|CML27_ORYSJ Probable calcium-binding protein CML27 OS=Oryza sativa subsp. japonica GN=CML27 PE=2 SV=1 11 73 7.0E-09
sp|P43645|CATR_SPESI Caltractin (Fragment) OS=Spermatozopsis similis PE=2 SV=1 12 75 8.0E-09
sp|Q9R1K9|CETN2_MOUSE Centrin-2 OS=Mus musculus GN=Cetn2 PE=1 SV=1 12 75 8.0E-09
sp|Q9NP86|CABP5_HUMAN Calcium-binding protein 5 OS=Homo sapiens GN=CABP5 PE=1 SV=1 81 149 8.0E-09
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 69 148 8.0E-09
sp|Q9NZU7|CABP1_HUMAN Calcium-binding protein 1 OS=Homo sapiens GN=CABP1 PE=1 SV=5 10 75 9.0E-09
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 16 75 9.0E-09
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 16 91 9.0E-09
sp|P41208|CETN2_HUMAN Centrin-2 OS=Homo sapiens GN=CETN2 PE=1 SV=1 12 75 1.0E-08
sp|P41210|CATR_ATRNU Caltractin OS=Atriplex nummularia PE=2 SV=1 12 75 1.0E-08
sp|Q9NPB3|CABP2_HUMAN Calcium-binding protein 2 OS=Homo sapiens GN=CABP2 PE=1 SV=4 10 75 1.0E-08
sp|Q0DJ94|CML21_ORYSJ Probable calcium-binding protein CML21 OS=Oryza sativa subsp. japonica GN=CML21 PE=2 SV=2 14 74 1.0E-08
sp|Q06827|CATR_SCHDU Caltractin OS=Scherffelia dubia PE=1 SV=1 12 75 2.0E-08
sp|P43646|CATR_TETST Caltractin (Fragment) OS=Tetraselmis striata PE=2 SV=1 12 75 2.0E-08
sp|O23184|CML19_ARATH Calcium-binding protein CML19 OS=Arabidopsis thaliana GN=CML19 PE=1 SV=1 10 75 2.0E-08
sp|O64943|POLC2_JUNOX Polcalcin Jun o 2 OS=Juniperus oxycedrus PE=1 SV=2 9 79 2.0E-08
sp|Q9LI84|CML16_ARATH Probable calcium-binding protein CML16 OS=Arabidopsis thaliana GN=CML16 PE=2 SV=2 12 79 2.0E-08
sp|Q8RZB5|CML10_ORYSJ Probable calcium-binding protein CML10 OS=Oryza sativa subsp. japonica GN=CML10 PE=2 SV=1 12 74 2.0E-08
sp|Q9N1Q9|CABP2_BOVIN Calcium-binding protein 2 OS=Bos taurus GN=CABP2 PE=2 SV=3 10 75 2.0E-08
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 16 75 2.0E-08
sp|Q12798|CETN1_HUMAN Centrin-1 OS=Homo sapiens GN=CETN1 PE=1 SV=1 12 75 3.0E-08
sp|Q6L5F4|CML14_ORYSJ Probable calcium-binding protein CML14 OS=Oryza sativa subsp. japonica GN=CML14 PE=2 SV=1 11 79 3.0E-08
sp|Q9LE22|CML27_ARATH Probable calcium-binding protein CML27 OS=Arabidopsis thaliana GN=CML27 PE=1 SV=1 6 73 3.0E-08
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 79 149 3.0E-08
sp|Q9JLK3|CABP5_MOUSE Calcium-binding protein 5 OS=Mus musculus GN=Cabp5 PE=1 SV=1 81 149 4.0E-08
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 70 149 4.0E-08
sp|P57796|CABP4_HUMAN Calcium-binding protein 4 OS=Homo sapiens GN=CABP4 PE=1 SV=2 10 75 5.0E-08
sp|P41209|CETN1_MOUSE Centrin-1 OS=Mus musculus GN=Cetn1 PE=1 SV=1 1 75 6.0E-08
sp|Q9JLK4|CABP2_MOUSE Calcium-binding protein 2 OS=Mus musculus GN=Cabp2 PE=2 SV=3 10 75 6.0E-08
sp|O01305|CAVP_BRAFL Calcium vector protein OS=Branchiostoma floridae PE=2 SV=3 12 75 6.0E-08
sp|Q03975|LPS1B_LYTPI Calcium-binding protein LPS1-beta (Fragment) OS=Lytechinus pictus PE=2 SV=2 2 101 6.0E-08
sp|P54213|CATR_DUNSA Caltractin OS=Dunaliella salina PE=2 SV=1 12 75 7.0E-08
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 79 149 7.0E-08
sp|P04573|CAVP_BRALA Calcium vector protein OS=Branchiostoma lanceolatum PE=1 SV=3 12 75 7.0E-08
sp|Q09011|CAST_SOLTU Calcium-binding protein CAST OS=Solanum tuberosum PE=2 SV=1 11 73 7.0E-08
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 82 149 8.0E-08
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 82 148 9.0E-08
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 70 149 9.0E-08
sp|O00897|CALML_DICDI Calmodulin-like protein OS=Dictyostelium discoideum GN=calB PE=2 SV=1 87 149 1.0E-07
sp|P80322|TNNC_BRALA Troponin C OS=Branchiostoma lanceolatum PE=1 SV=1 74 146 1.0E-07
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 82 149 1.0E-07
sp|Q9C8Y1|CML23_ARATH Probable calcium-binding protein CML23 OS=Arabidopsis thaliana GN=CML23 PE=2 SV=1 82 145 1.0E-07
sp|Q8VHC5|CABP4_MOUSE Calcium-binding protein 4 OS=Mus musculus GN=Cabp4 PE=1 SV=1 10 74 1.0E-07
sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 16 101 1.0E-07
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 82 149 1.0E-07
sp|Q9ZQE6|CML1_ARATH Calmodulin-like protein 1 OS=Arabidopsis thaliana GN=CML1 PE=2 SV=1 11 74 1.0E-07
sp|Q8RYJ8|CML19_ORYSJ Putative calcium-binding protein CML19 OS=Oryza sativa subsp. japonica GN=CML19 PE=3 SV=1 7 73 1.0E-07
sp|P06706|TNNC_HALRO Troponin C, body wall muscle OS=Halocynthia roretzi PE=1 SV=2 81 149 2.0E-07
sp|Q9JLK7|CABP1_MOUSE Calcium-binding protein 1 OS=Mus musculus GN=Cabp1 PE=1 SV=3 84 149 2.0E-07
sp|Q9N1R0|CABP1_BOVIN Calcium-binding protein 1 OS=Bos taurus GN=CABP1 PE=1 SV=3 84 149 2.0E-07
sp|Q8HZJ4|CABP4_BOVIN Calcium-binding protein 4 OS=Bos taurus GN=CABP4 PE=2 SV=1 1 75 2.0E-07
sp|Q9C9U8|CML26_ARATH Probable calcium-binding protein CML26 OS=Arabidopsis thaliana GN=CML26 PE=1 SV=1 12 74 2.0E-07
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 16 91 2.0E-07
sp|Q9SVG9|CML42_ARATH Calcium-binding protein CML42 OS=Arabidopsis thaliana GN=CML42 PE=1 SV=1 4 73 2.0E-07
sp|Q9FI19|CML43_ARATH Probable calcium-binding protein CML43 OS=Arabidopsis thaliana GN=CML43 PE=2 SV=1 11 73 2.0E-07
sp|P53441|CATR_NAEGR Caltractin OS=Naegleria gruberi GN=CTN PE=2 SV=1 11 75 3.0E-07
sp|O88751|CABP1_RAT Calcium-binding protein 1 OS=Rattus norvegicus GN=Cabp1 PE=1 SV=2 84 149 3.0E-07
sp|Q9NZU7|CABP1_HUMAN Calcium-binding protein 1 OS=Homo sapiens GN=CABP1 PE=1 SV=5 84 149 4.0E-07
sp|P53141|MLC1_YEAST Myosin light chain 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLC1 PE=1 SV=1 3 76 4.0E-07
sp|Q9SSF8|CDPKU_ARATH Calcium-dependent protein kinase 30 OS=Arabidopsis thaliana GN=CPK30 PE=1 SV=1 84 148 4.0E-07
sp|O82659|CML20_ARATH Probable calcium-binding protein CML20 OS=Arabidopsis thaliana GN=CML20 PE=1 SV=1 12 75 9.0E-07
sp|P19123|TNNC1_MOUSE Troponin C, slow skeletal and cardiac muscles OS=Mus musculus GN=Tnnc1 PE=1 SV=1 85 148 1.0E-06
sp|P63317|TNNC1_PIG Troponin C, slow skeletal and cardiac muscles OS=Sus scrofa GN=TNNC1 PE=1 SV=1 85 148 1.0E-06
sp|P63315|TNNC1_BOVIN Troponin C, slow skeletal and cardiac muscles OS=Bos taurus GN=TNNC1 PE=1 SV=1 85 148 1.0E-06
sp|P02591|TNNC1_RABIT Troponin C, slow skeletal and cardiac muscles OS=Oryctolagus cuniculus GN=TNNC1 PE=1 SV=1 85 148 1.0E-06
sp|P63316|TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles OS=Homo sapiens GN=TNNC1 PE=1 SV=1 85 148 1.0E-06
sp|P09860|TNNC1_CHICK Troponin C, slow skeletal and cardiac muscles OS=Gallus gallus GN=TNNC1 PE=1 SV=1 85 148 1.0E-06
sp|Q9S744|CML9_ARATH Calmodulin-like protein 9 OS=Arabidopsis thaliana GN=CML9 PE=1 SV=1 84 148 1.0E-06
sp|Q9LQN4|CML17_ARATH Probable calcium-binding protein CML17 OS=Arabidopsis thaliana GN=CML17 PE=2 SV=1 73 146 1.0E-06
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 15 83 1.0E-06
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 70 149 1.0E-06
sp|Q07167|SM16_SCHMA 16 kDa calcium-binding protein OS=Schistosoma mansoni PE=2 SV=1 7 78 1.0E-06
sp|P06704|CDC31_YEAST Cell division control protein 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC31 PE=1 SV=2 81 149 2.0E-06
sp|Q9ZSA3|CDPKM_ARATH Calcium-dependent protein kinase 22 OS=Arabidopsis thaliana GN=CPK22 PE=3 SV=2 82 149 2.0E-06
sp|P05936|TNNC1_COTJA Troponin C, slow skeletal and cardiac muscles OS=Coturnix coturnix japonica GN=TNNC1 PE=2 SV=1 85 148 3.0E-06
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 82 149 3.0E-06
sp|Q9S9V0|CDPKV_ARATH Calcium-dependent protein kinase 31 OS=Arabidopsis thaliana GN=CPK31 PE=2 SV=2 82 149 3.0E-06
sp|P30644|YNE5_CAEEL Uncharacterized calcium-binding protein R08D7.5 OS=Caenorhabditis elegans GN=R08D7.5 PE=3 SV=2 2 75 3.0E-06
sp|Q24956|CATR_GIAIN Caltractin OS=Giardia intestinalis GN=CAL PE=3 SV=1 75 149 4.0E-06
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 86 149 4.0E-06
sp|P34368|YLJ5_CAEEL Uncharacterized calcium-binding protein C50C3.5 OS=Caenorhabditis elegans GN=C50C3.5 PE=3 SV=3 82 149 6.0E-06
sp|P25070|CML24_ARATH Calcium-binding protein CML24 OS=Arabidopsis thaliana GN=CML24 PE=2 SV=2 82 145 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4745
MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMAR
KMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQDGDGRIDYNEFVQLMMQK*
Coding >OphauB2|4745
ATGGCCGACTCTCTTACCGAGGAGCAGGTGTCCGAGTTCAAGGAGGCCTTTTCTCTATTTGACAAGGATGGCGAT
GGCCAAATCACGACCAAGGAACTTGGCACCGTTATGCGCTCTCTGGGCCAAAATCCATCCGAATCTGAGCTTCAA
GACATGATCAACGAGGTAGACGCCGACAACAATGGCACTATTGACTTTCCAGAGTTTCTCACCATGATGGCCCGG
AAAATGAAGGACACGGATTCCGAGGAGGAGATTCGAGAGGCTTTCAAGGTCTTTGACCGCGATAATAACGGCTTC
ATCTCGGCTGCTGAGCTACGTCACGTCATGACATCGATTGGCGAAAAGCTTACCGATGACGAGGTTGATGAAATG
ATTCGCGAGGCCGATCAGGACGGCGACGGCCGAATTGATTACAATGAATTTGTCCAGCTCATGATGCAGAAGTAA
Transcript >OphauB2|4745
ATGGCCGACTCTCTTACCGAGGAGCAGGTGTCCGAGTTCAAGGAGGCCTTTTCTCTATTTGACAAGGATGGCGAT
GGCCAAATCACGACCAAGGAACTTGGCACCGTTATGCGCTCTCTGGGCCAAAATCCATCCGAATCTGAGCTTCAA
GACATGATCAACGAGGTAGACGCCGACAACAATGGCACTATTGACTTTCCAGAGTTTCTCACCATGATGGCCCGG
AAAATGAAGGACACGGATTCCGAGGAGGAGATTCGAGAGGCTTTCAAGGTCTTTGACCGCGATAATAACGGCTTC
ATCTCGGCTGCTGAGCTACGTCACGTCATGACATCGATTGGCGAAAAGCTTACCGATGACGAGGTTGATGAAATG
ATTCGCGAGGCCGATCAGGACGGCGACGGCCGAATTGATTACAATGAATTTGTCCAGCTCATGATGCAGAAGTAA
Gene >OphauB2|4745
ATGGTAAGCCCTTTTCCATGGACATGTCCTCTGCGCCACCCCCGCCGCCGCTCTCACGCTTCTTGATGGAGAACC
AAACCACGCTGCACTACTGCTCAGCACTTGATGCTGTTAATGCTTCTTTGCTGCTGATGCGCAGACTTGACAGGC
CGACTCTCTTACCGAGGAGCAGGTGTCCGAGTTCAAGGAGGCCTTTTCTCTATTTGTAAGCCCTTGTTTTCCCAT
TGCTGTATGCGCATCACTGCTGACGCGCCGCTGGTAAAGGACAAGGATGGCGATGGTAAGTTTGGCTCTCGCTTT
GCATCCAGTCAAAATCAGCGTCCCGCTCATGGCTCCTCGCCTCCCACGTGCAGGCCAAATCACGACCAAGGAACT
TGGCACCGTTATGCGCTCTCTGGGCCAAAATCCATCCGAATCTGAGCTTCAAGACATGATCAACGAGGTAGACGC
CGACAACAATGGCACTATTGACTTTCCAGGTGCGCCACTACATGTGCTCTGTTGGTTTACCGAGGCTCATATCAT
ATCTCCCTTGTCTAGAGTTTCTCACCATGATGGCCCGGAAAATGAAGGACACGGATTCCGAGGAGGAGATTCGAG
AGGCTTTCAAGGTTGGTGTCGCAGCATGGCTTCTTTATTTGATTGCACCTTGCTTATTACTCGCAGGTCTTTGAC
CGCGATAATAACGGCTTCATCTCGGCTGCTGAGCTACGTCACGTCATGACATCGATTGGCGAAAAGCTTACCGAT
GACGAGGTTGATGAAATGATTCGCGAGGCCGATCAGGACGGCGACGGCCGAATTGATTGTATAGCAGCTTCTAAT
CCCGCCTTTGTTGCTTGTTCTGAAGCTGACTACCCGAGGCAGACAATGAATTTGTCCAGCTCATGATGCAGAAGT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail