Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4737
Gene name
LocationContig_324:1465..3013
Strand+
Gene length (bp)1548
Transcript length (bp)1548
Coding sequence length (bp)1548
Protein length (aa) 516

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10998 DUF2838 Protein of unknown function (DUF2838) 6.9E-44 126 236

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94673|YG75_SCHPO Uncharacterized membrane protein C776.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC776.05 PE=4 SV=2 49 423 3.0E-103
sp|P48236|YG3L_YEAST Uncharacterized membrane protein YGR149W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR149W PE=1 SV=1 97 422 1.0E-71

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 128 147 19
2 151 170 19
3 177 199 22
4 203 222 19
5 234 256 22
6 283 305 22
7 376 398 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4737
MDDSPPHSPLSAPCESPSQSSQVDDGWDSLPPLDRLSLLDLLDNLALPQHLERLQRGISAQKDKVRRSRDALRSR
TQLARDRVVDEWRRRLPSADDQLDRYRLRMRRRVDDLARHWSDAKVVSAREKAAFIGGVVNIFFSGYLIGGYPQY
FHLWYTVQLLYFMPIRFIIYHRRGYHYFLADLCYFVNLLLALSIWAFPASKRLFTSAYCLAFGNNAIAIVMWRNS
LVFHSFDKVTSLFIHIMPCATLHCIVHLLPPDLLRHRFPAAWIIKNSAPDSPTAYANLASMLAWSSLPYALWQLF
YYFFITVRRRDKIAAGRPTSFTWLRRSYSATWIGRLVLSLPRRLQEPAFMLIQYSYALLTMLPCPLWFMSRYASS
AFLLIVFIWSIYNGSTYYIDVFGKRFQNELEAMKTEVSKWQNNADAISQSPLLSPQPDDASSSQPIAAQRQELCR
HLYTAENDLASRMPSKPSRHNDISKSSVDHIPLLDNAHSSVTSTERESNTPVRRILLSPSYTQNS*
Coding >OphauB2|4737
ATGGACGACTCGCCGCCGCATTCGCCTCTGTCTGCTCCTTGCGAGTCGCCCTCACAGTCGTCTCAAGTCGACGAT
GGCTGGGACTCGCTTCCTCCTCTGGACCGGCTTTCCCTCCTTGATCTCCTCGACAACCTGGCGCTGCCTCAGCAC
CTCGAGCGTCTCCAGCGCGGCATCTCGGCCCAAAAGGACAAGGTGCGCCGCTCTCGTGACGCCCTCCGCTCTCGC
ACTCAGCTCGCCCGCGACCGCGTAGTTGACGAATGGCGCCGACGCCTTCCCTCAGCCGACGACCAACTCGATCGC
TATCGCCTGCGCATGCGCCGCCGCGTCGATGATCTCGCCCGGCATTGGTCAGATGCAAAAGTCGTCAGCGCACGC
GAAAAGGCCGCCTTTATTGGCGGTGTGGTCAACATTTTTTTTAGCGGCTACCTCATTGGCGGCTACCCTCAGTAC
TTTCACCTCTGGTACACGGTCCAGCTGCTCTACTTTATGCCTATTCGCTTCATCATCTACCATCGGCGAGGCTAC
CACTACTTCCTAGCCGACCTCTGCTACTTTGTCAACCTTCTTCTCGCCCTCAGCATCTGGGCATTTCCCGCCTCC
AAGCGCCTCTTCACTTCAGCCTACTGTCTCGCCTTTGGCAATAACGCCATTGCTATTGTCATGTGGCGCAACTCG
CTCGTCTTCCACAGCTTTGACAAAGTAACCTCGCTCTTCATACACATCATGCCTTGTGCTACCTTGCACTGCATA
GTCCATCTCTTGCCTCCCGACCTGCTGCGCCATCGTTTTCCCGCCGCATGGATCATCAAGAACTCGGCTCCCGAC
TCTCCTACCGCCTATGCCAATCTTGCCTCTATGCTGGCCTGGAGCTCCCTGCCTTATGCTCTTTGGCAGCTTTTC
TACTACTTCTTCATTACTGTTCGTCGCCGCGACAAGATTGCCGCCGGTCGTCCCACCTCCTTCACTTGGCTACGC
CGTTCCTACTCAGCCACCTGGATCGGTCGTCTTGTCCTCTCTCTCCCCCGACGCCTCCAAGAACCGGCTTTCATG
CTTATTCAGTATTCTTACGCTCTTCTCACTATGCTACCCTGTCCCTTGTGGTTCATGAGCCGTTACGCTTCGTCA
GCCTTTCTACTCATCGTCTTCATCTGGAGCATATACAATGGTTCCACCTATTATATCGACGTATTCGGCAAGCGC
TTCCAAAACGAACTCGAGGCCATGAAGACCGAAGTCTCCAAGTGGCAAAATAATGCTGATGCAATCTCGCAATCT
CCTCTGCTTAGTCCGCAACCCGATGATGCATCATCCTCTCAGCCTATAGCTGCCCAACGTCAAGAGCTTTGCCGA
CATCTTTATACGGCAGAAAATGACCTTGCCAGCCGCATGCCATCCAAGCCAAGTCGCCATAATGACATCTCAAAG
TCTAGTGTCGACCACATTCCACTCCTCGACAATGCCCATTCCTCAGTAACGAGTACCGAGCGTGAATCCAATACC
CCAGTCCGCAGAATACTACTCTCACCCAGCTATACTCAGAACAGTTAA
Transcript >OphauB2|4737
ATGGACGACTCGCCGCCGCATTCGCCTCTGTCTGCTCCTTGCGAGTCGCCCTCACAGTCGTCTCAAGTCGACGAT
GGCTGGGACTCGCTTCCTCCTCTGGACCGGCTTTCCCTCCTTGATCTCCTCGACAACCTGGCGCTGCCTCAGCAC
CTCGAGCGTCTCCAGCGCGGCATCTCGGCCCAAAAGGACAAGGTGCGCCGCTCTCGTGACGCCCTCCGCTCTCGC
ACTCAGCTCGCCCGCGACCGCGTAGTTGACGAATGGCGCCGACGCCTTCCCTCAGCCGACGACCAACTCGATCGC
TATCGCCTGCGCATGCGCCGCCGCGTCGATGATCTCGCCCGGCATTGGTCAGATGCAAAAGTCGTCAGCGCACGC
GAAAAGGCCGCCTTTATTGGCGGTGTGGTCAACATTTTTTTTAGCGGCTACCTCATTGGCGGCTACCCTCAGTAC
TTTCACCTCTGGTACACGGTCCAGCTGCTCTACTTTATGCCTATTCGCTTCATCATCTACCATCGGCGAGGCTAC
CACTACTTCCTAGCCGACCTCTGCTACTTTGTCAACCTTCTTCTCGCCCTCAGCATCTGGGCATTTCCCGCCTCC
AAGCGCCTCTTCACTTCAGCCTACTGTCTCGCCTTTGGCAATAACGCCATTGCTATTGTCATGTGGCGCAACTCG
CTCGTCTTCCACAGCTTTGACAAAGTAACCTCGCTCTTCATACACATCATGCCTTGTGCTACCTTGCACTGCATA
GTCCATCTCTTGCCTCCCGACCTGCTGCGCCATCGTTTTCCCGCCGCATGGATCATCAAGAACTCGGCTCCCGAC
TCTCCTACCGCCTATGCCAATCTTGCCTCTATGCTGGCCTGGAGCTCCCTGCCTTATGCTCTTTGGCAGCTTTTC
TACTACTTCTTCATTACTGTTCGTCGCCGCGACAAGATTGCCGCCGGTCGTCCCACCTCCTTCACTTGGCTACGC
CGTTCCTACTCAGCCACCTGGATCGGTCGTCTTGTCCTCTCTCTCCCCCGACGCCTCCAAGAACCGGCTTTCATG
CTTATTCAGTATTCTTACGCTCTTCTCACTATGCTACCCTGTCCCTTGTGGTTCATGAGCCGTTACGCTTCGTCA
GCCTTTCTACTCATCGTCTTCATCTGGAGCATATACAATGGTTCCACCTATTATATCGACGTATTCGGCAAGCGC
TTCCAAAACGAACTCGAGGCCATGAAGACCGAAGTCTCCAAGTGGCAAAATAATGCTGATGCAATCTCGCAATCT
CCTCTGCTTAGTCCGCAACCCGATGATGCATCATCCTCTCAGCCTATAGCTGCCCAACGTCAAGAGCTTTGCCGA
CATCTTTATACGGCAGAAAATGACCTTGCCAGCCGCATGCCATCCAAGCCAAGTCGCCATAATGACATCTCAAAG
TCTAGTGTCGACCACATTCCACTCCTCGACAATGCCCATTCCTCAGTAACGAGTACCGAGCGTGAATCCAATACC
CCAGTCCGCAGAATACTACTCTCACCCAGCTATACTCAGAACAGTTAA
Gene >OphauB2|4737
ATGGACGACTCGCCGCCGCATTCGCCTCTGTCTGCTCCTTGCGAGTCGCCCTCACAGTCGTCTCAAGTCGACGAT
GGCTGGGACTCGCTTCCTCCTCTGGACCGGCTTTCCCTCCTTGATCTCCTCGACAACCTGGCGCTGCCTCAGCAC
CTCGAGCGTCTCCAGCGCGGCATCTCGGCCCAAAAGGACAAGGTGCGCCGCTCTCGTGACGCCCTCCGCTCTCGC
ACTCAGCTCGCCCGCGACCGCGTAGTTGACGAATGGCGCCGACGCCTTCCCTCAGCCGACGACCAACTCGATCGC
TATCGCCTGCGCATGCGCCGCCGCGTCGATGATCTCGCCCGGCATTGGTCAGATGCAAAAGTCGTCAGCGCACGC
GAAAAGGCCGCCTTTATTGGCGGTGTGGTCAACATTTTTTTTAGCGGCTACCTCATTGGCGGCTACCCTCAGTAC
TTTCACCTCTGGTACACGGTCCAGCTGCTCTACTTTATGCCTATTCGCTTCATCATCTACCATCGGCGAGGCTAC
CACTACTTCCTAGCCGACCTCTGCTACTTTGTCAACCTTCTTCTCGCCCTCAGCATCTGGGCATTTCCCGCCTCC
AAGCGCCTCTTCACTTCAGCCTACTGTCTCGCCTTTGGCAATAACGCCATTGCTATTGTCATGTGGCGCAACTCG
CTCGTCTTCCACAGCTTTGACAAAGTAACCTCGCTCTTCATACACATCATGCCTTGTGCTACCTTGCACTGCATA
GTCCATCTCTTGCCTCCCGACCTGCTGCGCCATCGTTTTCCCGCCGCATGGATCATCAAGAACTCGGCTCCCGAC
TCTCCTACCGCCTATGCCAATCTTGCCTCTATGCTGGCCTGGAGCTCCCTGCCTTATGCTCTTTGGCAGCTTTTC
TACTACTTCTTCATTACTGTTCGTCGCCGCGACAAGATTGCCGCCGGTCGTCCCACCTCCTTCACTTGGCTACGC
CGTTCCTACTCAGCCACCTGGATCGGTCGTCTTGTCCTCTCTCTCCCCCGACGCCTCCAAGAACCGGCTTTCATG
CTTATTCAGTATTCTTACGCTCTTCTCACTATGCTACCCTGTCCCTTGTGGTTCATGAGCCGTTACGCTTCGTCA
GCCTTTCTACTCATCGTCTTCATCTGGAGCATATACAATGGTTCCACCTATTATATCGACGTATTCGGCAAGCGC
TTCCAAAACGAACTCGAGGCCATGAAGACCGAAGTCTCCAAGTGGCAAAATAATGCTGATGCAATCTCGCAATCT
CCTCTGCTTAGTCCGCAACCCGATGATGCATCATCCTCTCAGCCTATAGCTGCCCAACGTCAAGAGCTTTGCCGA
CATCTTTATACGGCAGAAAATGACCTTGCCAGCCGCATGCCATCCAAGCCAAGTCGCCATAATGACATCTCAAAG
TCTAGTGTCGACCACATTCCACTCCTCGACAATGCCCATTCCTCAGTAACGAGTACCGAGCGTGAATCCAATACC
CCAGTCCGCAGAATACTACTCTCACCCAGCTATACTCAGAACAGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail