Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4734
Gene name
LocationContig_323:482..1741
Strand+
Gene length (bp)1259
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 6.6E-18 70 139

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10422|YDC1_SCHPO Uncharacterized RNA-binding protein C25G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.01 PE=1 SV=1 43 219 1.0E-24
sp|P62997|TRA2B_RAT Transformer-2 protein homolog beta OS=Rattus norvegicus GN=Tra2b PE=1 SV=1 65 216 4.0E-14
sp|P62996|TRA2B_MOUSE Transformer-2 protein homolog beta OS=Mus musculus GN=Tra2b PE=1 SV=1 65 216 4.0E-14
sp|P62995|TRA2B_HUMAN Transformer-2 protein homolog beta OS=Homo sapiens GN=TRA2B PE=1 SV=1 65 216 4.0E-14
sp|Q3ZBT6|TRA2B_BOVIN Transformer-2 protein homolog beta OS=Bos taurus GN=TRA2B PE=2 SV=1 65 216 4.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10422|YDC1_SCHPO Uncharacterized RNA-binding protein C25G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.01 PE=1 SV=1 43 219 1.0E-24
sp|P62997|TRA2B_RAT Transformer-2 protein homolog beta OS=Rattus norvegicus GN=Tra2b PE=1 SV=1 65 216 4.0E-14
sp|P62996|TRA2B_MOUSE Transformer-2 protein homolog beta OS=Mus musculus GN=Tra2b PE=1 SV=1 65 216 4.0E-14
sp|P62995|TRA2B_HUMAN Transformer-2 protein homolog beta OS=Homo sapiens GN=TRA2B PE=1 SV=1 65 216 4.0E-14
sp|Q3ZBT6|TRA2B_BOVIN Transformer-2 protein homolog beta OS=Bos taurus GN=TRA2B PE=2 SV=1 65 216 4.0E-14
sp|Q84TH4|SR45A_ARATH Serine/arginine-rich splicing factor SR45a OS=Arabidopsis thaliana GN=SR45A PE=1 SV=1 63 168 6.0E-14
sp|P19018|TRA2_DROME Transformer-2 sex-determining protein OS=Drosophila melanogaster GN=tra2 PE=1 SV=1 72 198 1.0E-13
sp|O02008|TRA2_DROVI Transformer-2 sex-determining protein OS=Drosophila virilis GN=tra2 PE=3 SV=1 72 168 2.0E-12
sp|Q54Y98|TRA2_DICDI Transformer-2 protein homolog OS=Dictyostelium discoideum GN=tra2 PE=3 SV=1 63 173 3.0E-12
sp|Q8N7X1|RMXL3_HUMAN RNA-binding motif protein, X-linked-like-3 OS=Homo sapiens GN=RBMXL3 PE=2 SV=2 70 176 9.0E-11
sp|Q6IRQ4|RBMX_XENLA RNA-binding motif protein, X chromosome OS=Xenopus laevis GN=rbmx PE=2 SV=1 69 153 2.0E-10
sp|P0C8Z4|RMXL3_PANTR RNA-binding motif protein, X-linked-like-3 OS=Pan troglodytes GN=RBMXL3 PE=3 SV=1 70 176 2.0E-10
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 70 147 2.0E-09
sp|Q91VM5|RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus GN=Rbmxl1 PE=2 SV=1 70 146 4.0E-09
sp|Q4V898|RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus GN=Rbmx PE=1 SV=1 69 146 4.0E-09
sp|Q8RWN5|RZ1C_ARATH Glycine-rich RNA-binding protein RZ1C OS=Arabidopsis thaliana GN=RZ1C PE=1 SV=1 63 144 4.0E-09
sp|Q4R7F0|RBMX_MACFA RNA-binding motif protein, X chromosome OS=Macaca fascicularis GN=RBMX PE=2 SV=1 70 146 4.0E-09
sp|A5A6M3|RBMX_PANTR RNA-binding motif protein, X chromosome OS=Pan troglodytes GN=RBMX PE=2 SV=1 70 146 4.0E-09
sp|P38159|RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens GN=RBMX PE=1 SV=3 70 146 4.0E-09
sp|Q9WV02|RBMX_MOUSE RNA-binding motif protein, X chromosome OS=Mus musculus GN=Rbmx PE=1 SV=1 69 146 5.0E-09
sp|Q96E39|RMXL1_HUMAN RNA binding motif protein, X-linked-like-1 OS=Homo sapiens GN=RBMXL1 PE=1 SV=1 70 146 5.0E-09
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 69 145 6.0E-09
sp|P84586|RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus GN=Rbmxrtl PE=1 SV=1 70 146 1.0E-08
sp|D4AE41|RMXL1_RAT RNA binding motif protein, X-linked-like-1 OS=Rattus norvegicus GN=Rbmxl1 PE=3 SV=1 70 146 2.0E-08
sp|Q4R813|RMXL2_MACFA RNA-binding motif protein, X-linked-like-2 OS=Macaca fascicularis GN=RBMXL2 PE=2 SV=1 69 146 3.0E-08
sp|Q14151|SAFB2_HUMAN Scaffold attachment factor B2 OS=Homo sapiens GN=SAFB2 PE=1 SV=1 51 145 3.0E-08
sp|Q6PFR5|TRA2A_MOUSE Transformer-2 protein homolog alpha OS=Mus musculus GN=Tra2a PE=1 SV=1 65 161 3.0E-08
sp|Q13595|TRA2A_HUMAN Transformer-2 protein homolog alpha OS=Homo sapiens GN=TRA2A PE=1 SV=1 65 161 3.0E-08
sp|Q8LPQ9|FPA_ARATH Flowering time control protein FPA OS=Arabidopsis thaliana GN=FPA PE=2 SV=2 67 149 3.0E-08
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 68 150 3.0E-08
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 70 156 3.0E-08
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 68 170 4.0E-08
sp|Q29RT0|RBMX_BOVIN RNA-binding motif protein, X chromosome OS=Bos taurus GN=RBMX PE=2 SV=1 69 146 4.0E-08
sp|Q57014|RBPA_SYNY3 Putative RNA-binding protein RbpA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rbpA PE=3 SV=3 69 145 4.0E-08
sp|O75526|RMXL2_HUMAN RNA-binding motif protein, X-linked-like-2 OS=Homo sapiens GN=RBMXL2 PE=1 SV=3 69 146 4.0E-08
sp|Q9CAE4|U1131_ARATH U11/U12 small nuclear ribonucleoprotein 31 kDa protein OS=Arabidopsis thaliana GN=SNRNP31 PE=2 SV=1 68 144 6.0E-08
sp|P30352|SRSF2_CHICK Serine/arginine-rich splicing factor 2 OS=Gallus gallus GN=SRSF2 PE=2 SV=1 68 149 6.0E-08
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 70 144 6.0E-08
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 70 144 6.0E-08
sp|Q9V535|RBM8A_DROME RNA-binding protein 8A OS=Drosophila melanogaster GN=tsu PE=1 SV=1 57 141 7.0E-08
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 70 144 7.0E-08
sp|Q5D018|RBM8A_DANRE RNA-binding protein 8A OS=Danio rerio GN=rbm8a PE=2 SV=1 67 141 8.0E-08
sp|O22703|RZ1B_ARATH Glycine-rich RNA-binding protein RZ1B OS=Arabidopsis thaliana GN=RZ1B PE=2 SV=1 65 144 8.0E-08
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 45 156 1.0E-07
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 70 144 1.0E-07
sp|Q60990|RBY1B_MOUSE RNA-binding motif protein, Y chromosome, family 1 member B OS=Mus musculus GN=Rbmy1b PE=2 SV=3 70 146 1.0E-07
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 70 141 1.0E-07
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 70 144 1.0E-07
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 70 144 1.0E-07
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 70 144 1.0E-07
sp|O35698|RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus GN=Rbmy1a1 PE=1 SV=2 64 146 1.0E-07
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 70 144 1.0E-07
sp|B5DGI7|RBM8A_SALSA RNA-binding protein 8A OS=Salmo salar GN=rbm8a PE=2 SV=1 67 141 2.0E-07
sp|Q9TTV2|ROA2_SAGOE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Saguinus oedipus GN=HNRNPA2B1 PE=1 SV=1 70 162 2.0E-07
sp|Q09511|RSP4_CAEEL Probable splicing factor, arginine/serine-rich 4 OS=Caenorhabditis elegans GN=rsp-4 PE=3 SV=1 64 149 2.0E-07
sp|Q9CWZ3|RBM8A_MOUSE RNA-binding protein 8A OS=Mus musculus GN=Rbm8a PE=1 SV=3 67 141 2.0E-07
sp|Q9LIN3|RZ1A_ARATH Glycine-rich RNA-binding protein RZ1A OS=Arabidopsis thaliana GN=RZ1A PE=1 SV=1 65 145 3.0E-07
sp|Q27W01|RBM8A_RAT RNA-binding protein 8A OS=Rattus norvegicus GN=Rbm8a PE=1 SV=1 67 141 3.0E-07
sp|Q9Y5S9|RBM8A_HUMAN RNA-binding protein 8A OS=Homo sapiens GN=RBM8A PE=1 SV=1 67 141 3.0E-07
sp|Q3ZCE8|RBM8A_BOVIN RNA-binding protein 8A OS=Bos taurus GN=RBM8A PE=2 SV=2 67 141 3.0E-07
sp|Q5R452|SAFB1_PONAB Scaffold attachment factor B1 OS=Pongo abelii GN=SAFB PE=2 SV=1 49 145 3.0E-07
sp|Q15424|SAFB1_HUMAN Scaffold attachment factor B1 OS=Homo sapiens GN=SAFB PE=1 SV=4 49 145 3.0E-07
sp|A5A6H4|ROA1_PANTR Heterogeneous nuclear ribonucleoprotein A1 OS=Pan troglodytes GN=HNRNPA1 PE=2 SV=1 70 162 3.0E-07
sp|P49312|ROA1_MOUSE Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus GN=Hnrnpa1 PE=1 SV=2 70 162 3.0E-07
sp|P09867|ROA1_BOVIN Heterogeneous nuclear ribonucleoprotein A1 OS=Bos taurus GN=HNRNPA1 PE=1 SV=2 70 162 3.0E-07
sp|Q2HJ60|ROA2_BOVIN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Bos taurus GN=HNRNPA2B1 PE=2 SV=1 70 162 3.0E-07
sp|A6NDE4|RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens GN=RBMY1B PE=2 SV=2 63 146 4.0E-07
sp|P04256|ROA1_RAT Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus GN=Hnrnpa1 PE=1 SV=3 70 162 4.0E-07
sp|Q06A98|SRSF2_PIG Serine/arginine-rich splicing factor 2 OS=Sus scrofa GN=SRSF2 PE=2 SV=1 68 149 4.0E-07
sp|Q5R1W5|SRSF2_PANTR Serine/arginine-rich splicing factor 2 OS=Pan troglodytes GN=SRSF2 PE=2 SV=3 68 149 4.0E-07
sp|Q28521|ROA1_MACMU Heterogeneous nuclear ribonucleoprotein A1 OS=Macaca mulatta GN=HNRNPA1 PE=2 SV=3 70 162 4.0E-07
sp|P0DJD3|RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens GN=RBMY1A1 PE=1 SV=1 63 146 4.0E-07
sp|A6NEQ0|RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens GN=RBMY1E PE=2 SV=1 63 146 4.0E-07
sp|P0C7P1|RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens GN=RBMY1D PE=2 SV=1 63 146 4.0E-07
sp|Q6PDU1|SRSF2_RAT Serine/arginine-rich splicing factor 2 OS=Rattus norvegicus GN=Srsf2 PE=1 SV=3 68 149 4.0E-07
sp|Q62093|SRSF2_MOUSE Serine/arginine-rich splicing factor 2 OS=Mus musculus GN=Srsf2 PE=1 SV=4 68 149 4.0E-07
sp|Q01130|SRSF2_HUMAN Serine/arginine-rich splicing factor 2 OS=Homo sapiens GN=SRSF2 PE=1 SV=4 68 149 4.0E-07
sp|Q3MHR5|SRSF2_BOVIN Serine/arginine-rich splicing factor 2 OS=Bos taurus GN=SRSF2 PE=2 SV=3 68 149 4.0E-07
sp|Q80YR5|SAFB2_MOUSE Scaffold attachment factor B2 OS=Mus musculus GN=Safb2 PE=1 SV=2 49 145 5.0E-07
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 70 144 5.0E-07
sp|Q9BRL6|SRSF8_HUMAN Serine/arginine-rich splicing factor 8 OS=Homo sapiens GN=SRSF8 PE=1 SV=1 59 145 5.0E-07
sp|P0DJD4|RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens GN=RBMY1C PE=1 SV=1 63 146 5.0E-07
sp|O88569|ROA2_MOUSE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus GN=Hnrnpa2b1 PE=1 SV=2 70 162 6.0E-07
sp|P22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens GN=HNRNPA2B1 PE=1 SV=2 70 162 6.0E-07
sp|A7VJC2|ROA2_RAT Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Rattus norvegicus GN=Hnrnpa2b1 PE=1 SV=1 70 162 6.0E-07
sp|Q15415|RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens GN=RBMY1F PE=1 SV=2 63 146 6.0E-07
sp|O93235|CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 70 144 6.0E-07
sp|Q5RBU8|ROA2_PONAB Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Pongo abelii GN=HNRNPA2B1 PE=2 SV=1 70 162 6.0E-07
sp|P09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 70 162 6.0E-07
sp|Q32P51|RA1L2_HUMAN Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens GN=HNRNPA1L2 PE=2 SV=2 70 162 6.0E-07
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 70 144 7.0E-07
sp|Q3SWU3|HNRDL_RAT Heterogeneous nuclear ribonucleoprotein D-like OS=Rattus norvegicus GN=Hnrnpdl PE=1 SV=1 23 158 8.0E-07
sp|O88453|SAFB1_RAT Scaffold attachment factor B1 OS=Rattus norvegicus GN=Safb PE=1 SV=2 49 145 9.0E-07
sp|Q9SEU4|SRC33_ARATH Serine/arginine-rich SC35-like splicing factor SCL33 OS=Arabidopsis thaliana GN=SCL33 PE=1 SV=1 23 144 9.0E-07
sp|Q28BZ1|RBM8A_XENTR RNA-binding protein 8A OS=Xenopus tropicalis GN=rbm8a PE=2 SV=1 67 141 9.0E-07
sp|Q9WX39|RBPF_NOSS1 Putative RNA-binding protein RbpF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpF PE=3 SV=3 69 145 1.0E-06
sp|P51990|RO22_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 2 OS=Xenopus laevis PE=2 SV=1 70 162 1.0E-06
sp|Q44556|RBPD_NOSS1 Putative RNA-binding protein RbpD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpD PE=3 SV=3 69 145 1.0E-06
sp|Q5ARI5|PPIL4_EMENI Peptidyl-prolyl cis-trans isomerase-like 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp6 PE=3 SV=1 66 264 1.0E-06
sp|Q99069|GRP1_SORBI Glycine-rich RNA-binding protein 1 (Fragment) OS=Sorghum bicolor GN=GRP1 PE=2 SV=1 88 145 1.0E-06
sp|Q96DH6|MSI2H_HUMAN RNA-binding protein Musashi homolog 2 OS=Homo sapiens GN=MSI2 PE=1 SV=1 55 153 1.0E-06
sp|Q920Q6|MSI2H_MOUSE RNA-binding protein Musashi homolog 2 OS=Mus musculus GN=Msi2 PE=1 SV=1 55 153 1.0E-06
sp|Q6PH90|RB8AB_XENLA RNA-binding protein 8A-B OS=Xenopus laevis GN=rbm8a-b PE=2 SV=1 67 141 1.0E-06
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 57 141 1.0E-06
sp|P17130|ROA1_XENLA Heterogeneous nuclear ribonucleoproteins A1 homolog OS=Xenopus laevis GN=hnrnpa1 PE=2 SV=1 70 162 1.0E-06
sp|D3YXK2|SAFB1_MOUSE Scaffold attachment factor B1 OS=Mus musculus GN=Safb PE=1 SV=2 49 145 2.0E-06
sp|Q9DF42|RB8AA_XENLA RNA-binding protein 8A-A OS=Xenopus laevis GN=rbm8a-a PE=2 SV=1 67 141 2.0E-06
sp|P48810|RB87F_DROME Heterogeneous nuclear ribonucleoprotein 87F OS=Drosophila melanogaster GN=Hrb87F PE=2 SV=2 70 150 2.0E-06
sp|Q02926|RB97D_DROME Ribonucleoprotein RB97D OS=Drosophila melanogaster GN=Rb97D PE=2 SV=1 70 150 2.0E-06
sp|O01671|SXL_MEGSC Sex-lethal homolog OS=Megaselia scalaris GN=SXL PE=2 SV=3 68 186 2.0E-06
sp|P0C1I6|PPIL4_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 4 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp13 PE=3 SV=1 66 216 2.0E-06
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 65 141 2.0E-06
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 68 146 3.0E-06
sp|P07909|ROA1_DROME Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster GN=Hrb98DE PE=2 SV=1 70 150 3.0E-06
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 68 145 3.0E-06
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 68 145 3.0E-06
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 68 145 3.0E-06
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 68 149 3.0E-06
sp|Q5ZI72|HNRDL_CHICK Heterogeneous nuclear ribonucleoprotein D-like OS=Gallus gallus GN=HNRNPDL PE=2 SV=1 50 158 3.0E-06
sp|Q44554|RBPB_NOSS1 Putative RNA-binding protein RbpB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpB PE=3 SV=3 69 145 3.0E-06
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 84 150 4.0E-06
sp|P51989|RO21_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 1 OS=Xenopus laevis PE=2 SV=1 70 162 4.0E-06
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 68 144 5.0E-06
sp|Q9USY2|YOW4_SCHPO Uncharacterized RNA-binding protein C1861.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1861.04c PE=3 SV=1 62 151 5.0E-06
sp|Q43349|CP29A_ARATH 29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP29A PE=2 SV=2 38 141 5.0E-06
sp|Q43472|GRP_HORVU Glycine-rich RNA-binding protein blt801 OS=Hordeum vulgare GN=blt801 PE=1 SV=1 71 149 6.0E-06
sp|Q9FMG4|SC35_ARATH Serine/arginine-rich splicing factor SC35 OS=Arabidopsis thaliana GN=SC35 PE=1 SV=1 69 145 6.0E-06
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 68 145 7.0E-06
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 68 145 8.0E-06
sp|P92964|SRS31_ARATH Serine/arginine-rich splicing factor RS31 OS=Arabidopsis thaliana GN=RS31 PE=1 SV=2 64 144 8.0E-06
sp|P51968|RO31_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 1 OS=Xenopus laevis PE=2 SV=1 70 200 8.0E-06
sp|Q99729|ROAA_HUMAN Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens GN=HNRNPAB PE=1 SV=2 42 159 9.0E-06
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 70 115 1.0E-05
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 68 145 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4734
MDYEAAGGDRYDEEAPRYERDNRSASPRPVRDDDGRRRSASPNGNTDLASKDMMSSKDDDDGAVNPGSNLFVTGI
HPRLAECDVATMFEKYGDVEKCQIMRDPHTKESRGFGFVKMITSAQAEAAKEGLQGEQIEGRTLSIEKARRARPR
TPTPGKYFGPPKREPRGRFDDRRRGGYGGSAGAGYGREDYRYRGYDRGYGSDRRNDDRGYDRGGYRDDRRYDDRG
YGRDYERGYERRDRGDDYYGRDRYGGREDRDRYGGRGNAGGYERDRYDRPADRDPTRNREPLGGGSGYGESASRG
DTRESYGGPDPTVR*
Coding >OphauB2|4734
ATGGACTATGAGGCTGCAGGTGGCGATCGGTACGACGAAGAGGCTCCGAGGTATGAGCGCGATAATCGAAGCGCC
TCTCCTCGCCCAGTTCGCGATGACGATGGCCGTCGTCGCTCGGCATCCCCAAATGGCAACACTGACTTGGCCTCT
AAGGACATGATGTCGTCCAAAGACGACGATGATGGCGCTGTGAATCCTGGCTCCAACCTCTTTGTCACTGGAATC
CATCCTCGCCTGGCCGAGTGTGATGTTGCAACAATGTTTGAAAAATATGGCGACGTTGAAAAATGCCAGATCATG
CGTGACCCGCACACCAAAGAGTCTCGCGGCTTTGGGTTCGTGAAAATGATCACTTCCGCACAGGCCGAGGCCGCC
AAAGAGGGCCTTCAGGGCGAACAGATTGAGGGCCGCACTTTGAGCATTGAAAAGGCTCGTCGTGCTCGCCCGCGT
ACTCCAACCCCTGGCAAATATTTTGGACCACCTAAACGTGAGCCCCGTGGTCGTTTTGATGACCGCCGACGTGGC
GGCTACGGTGGCAGTGCCGGCGCTGGTTATGGGCGCGAAGATTATCGTTATCGTGGATACGATCGGGGCTACGGC
TCAGACCGCAGAAATGATGACCGTGGCTACGATCGCGGTGGATATCGTGATGATCGACGTTACGATGATCGTGGT
TATGGCCGCGACTATGAACGAGGTTATGAACGCCGGGACCGAGGAGACGACTATTACGGCAGAGATCGTTATGGT
GGACGCGAAGATCGTGACCGCTATGGAGGTCGAGGTAATGCAGGTGGCTACGAACGCGACCGTTACGACCGTCCC
GCAGATCGCGACCCTACTCGCAATCGTGAGCCGCTTGGTGGTGGCTCTGGCTATGGCGAGTCTGCTTCCCGTGGT
GATACTCGCGAGTCTTATGGAGGCCCTGATCCGACAGTCCGATAG
Transcript >OphauB2|4734
ATGGACTATGAGGCTGCAGGTGGCGATCGGTACGACGAAGAGGCTCCGAGGTATGAGCGCGATAATCGAAGCGCC
TCTCCTCGCCCAGTTCGCGATGACGATGGCCGTCGTCGCTCGGCATCCCCAAATGGCAACACTGACTTGGCCTCT
AAGGACATGATGTCGTCCAAAGACGACGATGATGGCGCTGTGAATCCTGGCTCCAACCTCTTTGTCACTGGAATC
CATCCTCGCCTGGCCGAGTGTGATGTTGCAACAATGTTTGAAAAATATGGCGACGTTGAAAAATGCCAGATCATG
CGTGACCCGCACACCAAAGAGTCTCGCGGCTTTGGGTTCGTGAAAATGATCACTTCCGCACAGGCCGAGGCCGCC
AAAGAGGGCCTTCAGGGCGAACAGATTGAGGGCCGCACTTTGAGCATTGAAAAGGCTCGTCGTGCTCGCCCGCGT
ACTCCAACCCCTGGCAAATATTTTGGACCACCTAAACGTGAGCCCCGTGGTCGTTTTGATGACCGCCGACGTGGC
GGCTACGGTGGCAGTGCCGGCGCTGGTTATGGGCGCGAAGATTATCGTTATCGTGGATACGATCGGGGCTACGGC
TCAGACCGCAGAAATGATGACCGTGGCTACGATCGCGGTGGATATCGTGATGATCGACGTTACGATGATCGTGGT
TATGGCCGCGACTATGAACGAGGTTATGAACGCCGGGACCGAGGAGACGACTATTACGGCAGAGATCGTTATGGT
GGACGCGAAGATCGTGACCGCTATGGAGGTCGAGGTAATGCAGGTGGCTACGAACGCGACCGTTACGACCGTCCC
GCAGATCGCGACCCTACTCGCAATCGTGAGCCGCTTGGTGGTGGCTCTGGCTATGGCGAGTCTGCTTCCCGTGGT
GATACTCGCGAGTCTTATGGAGGCCCTGATCCGACAGTCCGATAG
Gene >OphauB2|4734
ATGGACTATGAGGCTGCAGGTGGCGATCGGTACGACGGTACGTCTCTTAATCTCCTGCCCACTCAATTTTCGATA
CAACGAGGCTCTCTTTCCTCCCTCATCGTCATATCGTGCCCGATTTTCTGTATATACACTGTTCATGCCCTCATT
CAATCGTTCTCCAGAAGAGGCTCCGAGGTATGAGCGCGATAATCGAAGCGCCTCTCCTCGCCCAGTTCGCGATGA
CGATGGCCGTCGTCGCTCGGCATCCCCAAATGGCAACACTGACTTGTAAGTCTACCCACTGGCACATATGCTTCC
ATGTGTGTTTTTACTGACAATTGAAACTATTTATTGCTGCATCGCATAGGGCCTCTAAGGACATGATGTCGTCCA
AAGACGACGATGATGGCGCTGTGAATCCTGGCTCCAACCTCTTTGTCACTGGAATCCATCCTCGCCTGGCCGAGT
GTGATGTTGCAACAATGTTTGAAAAATATGGCGACGTTGAAAAATGCCAGATCATGCGTGACCCGCACACCAAAG
AGTCTCGCGGCTTTGGGTTCGTGAAAATGATCACTTCCGCACAGGCCGAGGCCGCCAAAGAGGGCCTTCAGGGCG
AACAGATTGAGGGCCGCACTTTGAGCATTGAAAAGGCTCGTCGTGCTCGCCCGCGTACTCCAACCCCTGGCAAAT
ATTTTGGACCACCTAAACGTGGTACGTTGACTTCCAAAATACTCTCACTCGTGACTTTTCTCGCTGATGAGCCAT
TAGAGCCCCGTGGTCGTTTTGATGACCGCCGACGTGGCGGCTACGGTGGCAGTGCCGGCGCTGGTTATGGGCGCG
AAGATTATCGTTATCGTGGATACGATCGGGGCTACGGCTCAGACCGCAGAAATGATGACCGTGGCTACGATCGCG
GTGGATATCGTGATGATCGACGTTACGATGATCGTGGTTATGGCCGCGACTATGAACGAGGTTATGAACGCCGGG
ACCGAGGAGACGACTATTACGGCAGAGATCGTTATGGTGGACGCGAAGATCGTGACCGCTATGGAGGTCGAGGTA
ATGCAGGTGGCTACGAACGCGACCGTTACGACCGTCCCGCAGATCGCGACCCTACTCGCAATCGTGAGCCGCTTG
GTGGTGGCTCTGGCTATGGCGAGTCTGCTTCCCGTGGTGATACTCGCGAGTCTTATGGAGGTTTGAGTCATTCCG
ACGTAGTATCGCAGCGTCGTGTACTGATATTTCCAGGCCCTGATCCGACAGTCCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail