Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4717
Gene name
LocationContig_32:109551..112284
Strand+
Gene length (bp)2733
Transcript length (bp)2469
Coding sequence length (bp)2469
Protein length (aa) 823

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13086 AAA_11 AAA domain 2.9E-23 289 655
PF13087 AAA_12 AAA domain 1.1E-21 668 819
PF13245 AAA_19 AAA domain 1.2E-08 294 654

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74465|HRR1_SCHPO Helicase required for RNAi-mediated heterochromatin assembly 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrr1 PE=1 SV=2 35 820 4.0E-94
sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens GN=ZNFX1 PE=2 SV=2 534 820 7.0E-43
sp|Q8R151|ZNFX1_MOUSE NFX1-type zinc finger-containing protein 1 OS=Mus musculus GN=Znfx1 PE=1 SV=3 534 820 1.0E-42
sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens GN=ZNFX1 PE=2 SV=2 40 374 5.0E-20
sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 518 820 3.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74465|HRR1_SCHPO Helicase required for RNAi-mediated heterochromatin assembly 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrr1 PE=1 SV=2 35 820 4.0E-94
sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens GN=ZNFX1 PE=2 SV=2 534 820 7.0E-43
sp|Q8R151|ZNFX1_MOUSE NFX1-type zinc finger-containing protein 1 OS=Mus musculus GN=Znfx1 PE=1 SV=3 534 820 1.0E-42
sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens GN=ZNFX1 PE=2 SV=2 40 374 5.0E-20
sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 518 820 3.0E-19
sp|Q8R151|ZNFX1_MOUSE NFX1-type zinc finger-containing protein 1 OS=Mus musculus GN=Znfx1 PE=1 SV=3 40 374 7.0E-19
sp|O76512|RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans GN=smg-2 PE=1 SV=1 595 820 4.0E-18
sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 547 820 8.0E-18
sp|Q9VYS3|RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster GN=Upf1 PE=1 SV=2 547 820 5.0E-16
sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 576 820 1.0E-15
sp|Q9EPU0|RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2 518 820 3.0E-15
sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 518 820 3.0E-15
sp|Q09820|RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=upf1 PE=3 SV=2 550 818 1.0E-14
sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius OS=Mus musculus GN=Aqr PE=1 SV=2 560 820 4.0E-14
sp|O60306|AQR_HUMAN Intron-binding protein aquarius OS=Homo sapiens GN=AQR PE=1 SV=4 560 820 4.0E-14
sp|Q54I89|RENT1_DICDI Regulator of nonsense transcripts 1 OS=Dictyostelium discoideum GN=upf1 PE=3 SV=1 544 820 2.0E-13
sp|Q57568|Y104_METJA Uncharacterized ATP-dependent helicase MJ0104 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0104 PE=3 SV=1 617 820 8.0E-10
sp|Q0VGT4|ZGRF1_MOUSE Protein ZGRF1 OS=Mus musculus GN=Zgrf1 PE=1 SV=2 593 820 2.0E-09
sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen1 PE=1 SV=1 550 818 2.0E-09
sp|P34243|HCS1_YEAST DNA polymerase alpha-associated DNA helicase A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCS1 PE=1 SV=1 641 820 3.0E-09
sp|Q98TR3|RENT1_TAKRU Putative regulator of nonsense transcripts 1 OS=Takifugu rubripes GN=rent1 PE=3 SV=1 518 820 4.0E-09
sp|Q09820|RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=upf1 PE=3 SV=2 229 380 4.0E-09
sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 243 420 1.0E-08
sp|Q86YA3|ZGRF1_HUMAN Protein ZGRF1 OS=Homo sapiens GN=ZGRF1 PE=2 SV=3 593 820 1.0E-08
sp|Q86AS0|Y4399_DICDI Probable helicase DDB_G0274399 OS=Dictyostelium discoideum GN=DDB_G0274399 PE=3 SV=1 617 818 7.0E-08
sp|Q9EQN5|SMBP2_RAT DNA-binding protein SMUBP-2 OS=Rattus norvegicus GN=Ighmbp2 PE=1 SV=1 533 820 2.0E-07
sp|O94247|HCS1_SCHPO DNA polymerase alpha-associated DNA helicase A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hcs1 PE=3 SV=1 574 820 3.0E-07
sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 285 440 4.0E-07
sp|Q60560|SMBP2_MESAU DNA-binding protein SMUBP-2 OS=Mesocricetus auratus GN=IGHMBP2 PE=1 SV=1 617 820 4.0E-07
sp|P40694|SMBP2_MOUSE DNA-binding protein SMUBP-2 OS=Mus musculus GN=Ighmbp2 PE=1 SV=1 617 820 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004386 helicase activity Yes
GO:0003824 catalytic activity No
GO:0140657 ATP-dependent activity No
GO:0003674 molecular_function No
GO:0140640 catalytic activity, acting on a nucleic acid No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4717
MPFVAVQAGLVSRSSPTSSQLFLSRRFSSSALNMASTTTAWKEMPEIPTAEELLSPHNSALPQILEHGAMTKEEY
LEAQYLLHRHEATASLRAAVQQIRHGDLALGSEDANIYTKVRVLGFRPTKSGVAWRIVWKPNSPGHLMSISQPDC
LPSGTLVILSPKADSFRTQCLVATVAQKHPDEVQTARESSSCEIIWARCEDAILDPDVELIMLEPESGYFEPSRH
IMKGLKLAASASSRYDKYLFKTKNGASEKNEPVTFDEPVKSHVSADFLRLASKREPVASPAAVQLDSSQLEAVQQ
ATKQELAMIQGPPGTGKTFTSVVTIDSHLRTMEACHPTNDAPPPIIVVAETNHALDQLLTQCMSAGLRSILRLGH
NVQEDSVIYNKSLLKLLMRSRVKLPEKKADAKYKQAVKVLTSDLNQVFMDKAFYEAQALHDAELISPKQYLSLIE
DDGWETADAQDKRGPVAKWLNHSSVQSQCDPQQPVNNTIPHEGVFPNYIPFGVSTARGLLRSVERDGINDWAIRA
VRLLECSSDLYQIPLWQRRHIYCLLHKQMQERSIQNLLQAIKVFDIECEDFKKARSVNDAAVIRGEDIRIIGCTT
TGLAKYRRLLEILKPRILLVEEAAEVREGSIVAGLMPCIEQLVLVGDHQQLIPSVDVWELSRSPHRIDISLFERM
VKLEVPFCSLRVQRRMAPALRRVMQSFYPHIQDHASVKELPLVPGMSSRRLWWFDHQWEQSQTVGCSFVNTEEAD
MIVGFVGYLIQHGMSPSRITVLAYYSGQVALIQRKLKSHPNLARFDFERSVRTIDGFQGEENDVILLSLLWQ*
Coding >OphauB2|4717
ATGCCTTTTGTCGCCGTACAAGCCGGTCTTGTTTCTAGATCCTCTCCAACCTCGTCTCAACTCTTCTTGTCTCGT
CGCTTTTCAAGCTCTGCACTCAACATGGCGAGCACCACGACGGCTTGGAAGGAAATGCCCGAAATCCCCACGGCA
GAAGAACTGCTATCGCCTCATAACTCGGCACTGCCCCAGATTTTGGAGCATGGAGCAATGACCAAGGAGGAGTAT
CTGGAGGCTCAGTACCTCCTCCATCGCCACGAGGCCACGGCATCGCTTCGCGCCGCGGTGCAACAGATCCGCCAC
GGAGATCTGGCCTTGGGCTCTGAAGACGCAAACATCTATACCAAAGTACGCGTGTTGGGCTTTCGCCCCACCAAA
TCGGGCGTGGCGTGGCGCATCGTCTGGAAGCCGAACTCGCCTGGGCATTTGATGTCAATCAGTCAACCAGATTGC
CTGCCATCCGGCACTCTAGTAATCCTGAGCCCCAAGGCCGATTCTTTCCGTACCCAGTGCTTAGTGGCGACAGTA
GCCCAAAAACACCCGGACGAAGTCCAAACAGCAAGGGAATCTTCCTCTTGTGAGATTATTTGGGCCCGGTGCGAG
GATGCTATCTTGGACCCAGATGTTGAGTTGATCATGCTGGAGCCCGAGAGCGGCTATTTTGAACCGTCTCGGCAC
ATCATGAAGGGCCTCAAACTTGCCGCGTCGGCCAGCTCTCGATACGACAAGTACCTATTCAAGACTAAGAATGGT
GCTTCCGAAAAGAATGAGCCCGTCACATTCGATGAGCCCGTAAAATCTCACGTTTCTGCAGATTTTCTTCGTTTG
GCATCCAAAAGAGAGCCTGTGGCTTCTCCAGCCGCTGTCCAGTTAGACTCTTCACAATTGGAAGCTGTTCAGCAA
GCCACCAAGCAAGAGCTCGCCATGATTCAGGGCCCTCCAGGAACGGGCAAGACTTTTACCTCTGTGGTGACGATT
GACAGTCATTTGAGAACCATGGAGGCTTGTCATCCCACAAATGACGCTCCACCACCCATCATAGTGGTGGCTGAA
ACAAACCATGCATTGGACCAGCTCCTGACTCAATGTATGAGCGCAGGACTCAGGTCCATACTACGTCTTGGCCAC
AATGTCCAAGAAGACTCTGTGATCTACAACAAGTCTCTCTTGAAACTTCTCATGCGGTCAAGGGTGAAGCTGCCA
GAAAAGAAAGCCGATGCCAAGTACAAGCAAGCAGTCAAGGTGCTCACGTCTGACTTGAACCAAGTTTTCATGGAT
AAAGCCTTCTATGAGGCACAAGCGCTGCATGACGCTGAGCTCATTTCGCCGAAACAATACTTGTCGTTGATAGAA
GACGACGGCTGGGAGACTGCCGACGCCCAAGATAAACGAGGCCCTGTGGCAAAGTGGCTCAATCACTCCTCTGTT
CAAAGCCAATGCGACCCACAACAGCCCGTGAACAACACGATCCCACATGAGGGCGTTTTCCCAAACTATATCCCC
TTTGGAGTATCTACGGCCAGAGGCCTATTGCGAAGCGTTGAGCGCGACGGAATAAATGACTGGGCGATCAGGGCT
GTTCGCCTATTGGAATGCTCTTCTGATCTTTATCAGATTCCCCTGTGGCAGAGACGACATATCTACTGCCTTCTT
CATAAGCAGATGCAGGAACGCTCCATACAAAACCTTTTACAGGCCATCAAGGTATTTGATATTGAGTGCGAAGAT
TTCAAAAAGGCCAGATCGGTCAATGATGCGGCCGTTATTCGTGGAGAAGACATTCGCATCATTGGCTGCACTACT
ACTGGCTTGGCCAAGTATCGCCGTCTCCTTGAAATCCTGAAGCCTCGAATTTTGTTGGTGGAAGAGGCGGCAGAG
GTGCGCGAAGGCAGTATCGTGGCAGGATTGATGCCTTGCATCGAGCAACTTGTCTTGGTTGGAGACCACCAACAA
TTGATACCTAGCGTTGACGTTTGGGAGCTCAGCAGAAGCCCACATCGAATCGACATTTCCCTATTTGAGAGAATG
GTCAAGCTCGAGGTGCCTTTTTGCTCGTTGCGCGTCCAACGACGCATGGCTCCGGCTCTCCGGCGGGTGATGCAG
TCTTTCTATCCTCATATCCAAGACCATGCTAGCGTCAAGGAGCTACCTCTGGTGCCGGGCATGAGTTCGAGACGC
CTCTGGTGGTTTGATCACCAATGGGAACAGAGTCAGACAGTTGGGTGTTCGTTTGTAAACACGGAGGAAGCCGAC
ATGATTGTTGGCTTCGTCGGTTACTTGATTCAGCATGGCATGTCGCCAAGCCGCATCACGGTGCTGGCATACTAC
AGTGGTCAAGTTGCCCTGATACAGAGGAAGCTCAAGAGCCACCCAAACCTTGCCCGTTTTGACTTTGAGCGTTCG
GTTCGCACCATTGATGGATTTCAGGGGGAAGAAAACGATGTCATTTTGCTCTCGCTTTTGTGGCAATGA
Transcript >OphauB2|4717
ATGCCTTTTGTCGCCGTACAAGCCGGTCTTGTTTCTAGATCCTCTCCAACCTCGTCTCAACTCTTCTTGTCTCGT
CGCTTTTCAAGCTCTGCACTCAACATGGCGAGCACCACGACGGCTTGGAAGGAAATGCCCGAAATCCCCACGGCA
GAAGAACTGCTATCGCCTCATAACTCGGCACTGCCCCAGATTTTGGAGCATGGAGCAATGACCAAGGAGGAGTAT
CTGGAGGCTCAGTACCTCCTCCATCGCCACGAGGCCACGGCATCGCTTCGCGCCGCGGTGCAACAGATCCGCCAC
GGAGATCTGGCCTTGGGCTCTGAAGACGCAAACATCTATACCAAAGTACGCGTGTTGGGCTTTCGCCCCACCAAA
TCGGGCGTGGCGTGGCGCATCGTCTGGAAGCCGAACTCGCCTGGGCATTTGATGTCAATCAGTCAACCAGATTGC
CTGCCATCCGGCACTCTAGTAATCCTGAGCCCCAAGGCCGATTCTTTCCGTACCCAGTGCTTAGTGGCGACAGTA
GCCCAAAAACACCCGGACGAAGTCCAAACAGCAAGGGAATCTTCCTCTTGTGAGATTATTTGGGCCCGGTGCGAG
GATGCTATCTTGGACCCAGATGTTGAGTTGATCATGCTGGAGCCCGAGAGCGGCTATTTTGAACCGTCTCGGCAC
ATCATGAAGGGCCTCAAACTTGCCGCGTCGGCCAGCTCTCGATACGACAAGTACCTATTCAAGACTAAGAATGGT
GCTTCCGAAAAGAATGAGCCCGTCACATTCGATGAGCCCGTAAAATCTCACGTTTCTGCAGATTTTCTTCGTTTG
GCATCCAAAAGAGAGCCTGTGGCTTCTCCAGCCGCTGTCCAGTTAGACTCTTCACAATTGGAAGCTGTTCAGCAA
GCCACCAAGCAAGAGCTCGCCATGATTCAGGGCCCTCCAGGAACGGGCAAGACTTTTACCTCTGTGGTGACGATT
GACAGTCATTTGAGAACCATGGAGGCTTGTCATCCCACAAATGACGCTCCACCACCCATCATAGTGGTGGCTGAA
ACAAACCATGCATTGGACCAGCTCCTGACTCAATGTATGAGCGCAGGACTCAGGTCCATACTACGTCTTGGCCAC
AATGTCCAAGAAGACTCTGTGATCTACAACAAGTCTCTCTTGAAACTTCTCATGCGGTCAAGGGTGAAGCTGCCA
GAAAAGAAAGCCGATGCCAAGTACAAGCAAGCAGTCAAGGTGCTCACGTCTGACTTGAACCAAGTTTTCATGGAT
AAAGCCTTCTATGAGGCACAAGCGCTGCATGACGCTGAGCTCATTTCGCCGAAACAATACTTGTCGTTGATAGAA
GACGACGGCTGGGAGACTGCCGACGCCCAAGATAAACGAGGCCCTGTGGCAAAGTGGCTCAATCACTCCTCTGTT
CAAAGCCAATGCGACCCACAACAGCCCGTGAACAACACGATCCCACATGAGGGCGTTTTCCCAAACTATATCCCC
TTTGGAGTATCTACGGCCAGAGGCCTATTGCGAAGCGTTGAGCGCGACGGAATAAATGACTGGGCGATCAGGGCT
GTTCGCCTATTGGAATGCTCTTCTGATCTTTATCAGATTCCCCTGTGGCAGAGACGACATATCTACTGCCTTCTT
CATAAGCAGATGCAGGAACGCTCCATACAAAACCTTTTACAGGCCATCAAGGTATTTGATATTGAGTGCGAAGAT
TTCAAAAAGGCCAGATCGGTCAATGATGCGGCCGTTATTCGTGGAGAAGACATTCGCATCATTGGCTGCACTACT
ACTGGCTTGGCCAAGTATCGCCGTCTCCTTGAAATCCTGAAGCCTCGAATTTTGTTGGTGGAAGAGGCGGCAGAG
GTGCGCGAAGGCAGTATCGTGGCAGGATTGATGCCTTGCATCGAGCAACTTGTCTTGGTTGGAGACCACCAACAA
TTGATACCTAGCGTTGACGTTTGGGAGCTCAGCAGAAGCCCACATCGAATCGACATTTCCCTATTTGAGAGAATG
GTCAAGCTCGAGGTGCCTTTTTGCTCGTTGCGCGTCCAACGACGCATGGCTCCGGCTCTCCGGCGGGTGATGCAG
TCTTTCTATCCTCATATCCAAGACCATGCTAGCGTCAAGGAGCTACCTCTGGTGCCGGGCATGAGTTCGAGACGC
CTCTGGTGGTTTGATCACCAATGGGAACAGAGTCAGACAGTTGGGTGTTCGTTTGTAAACACGGAGGAAGCCGAC
ATGATTGTTGGCTTCGTCGGTTACTTGATTCAGCATGGCATGTCGCCAAGCCGCATCACGGTGCTGGCATACTAC
AGTGGTCAAGTTGCCCTGATACAGAGGAAGCTCAAGAGCCACCCAAACCTTGCCCGTTTTGACTTTGAGCGTTCG
GTTCGCACCATTGATGGATTTCAGGGGGAAGAAAACGATGTCATTTTGCTCTCGCTTTTGTGGCAATGA
Gene >OphauB2|4717
ATGCCTTTTGTCGCCGTACAAGCCGGTCTTGTTTCTAGATCCTCTCCAACCTCGTCTCAACTCTTCTTGTCTCGT
CGCTTTTCAAGCTCTGGTGCGTATTCCCTGGCTGCCTTTTGTGTTTGCAGCGCTCATTTTCATCGTCGGTTGCTG
ATGGCTTTGGCAAGCACTCAACATGGCGAGCACCACGACGGCTTGGAAGGAAATGCCCGAAATCCCCACGGCAGA
AGAACTGCTATCGCCTCATAACTCGGCACTGCCCCAGATTTTGGAGCATGGAGCAATGACCAAGGAGGAGTATCT
GGAGGCTCAGTACCTCCTCCATCGCCACGAGGCCACGGCATCGCTTCGCGCCGCGGTGCAACAGATCCGCCACGG
AGATCTGGCCTTGGGCTCTGAAGACGCAAACATCTATACCAAAGTATATGCTTTGTTGATGCCTTTATTGGCCTT
GTGTTTTACTCATTCTTTGTATAGGTACGCGTGTTGGGCTTTCGCCCCACCAAATCGGGCGTGGCGTGGCGCATC
GTCTGGAAGCCGAACTCGCCTGGGCATTTGATGTCAATCAGTCAACCAGATTGCCTGCCATCCGGCACTCTAGTA
ATCCTGAGCCCCAAGGCCGATTCTTTCCGTACCCAGTGCTTAGTGGCGACAGTAGCCCAAAAACACCCGGACGAA
GTCCAAACAGCAAGGGAATCTTCCTCTTGTGAGATTATTTGGGCCCGGTGCGAGGATGCTATCTTGGACCCAGAT
GTTGAGTTGATCATGCTGGAGCCCGAGAGCGGCTATTTTGAACCGTCTCGGCACATCATGAAGGGCCTCAAACTT
GCCGCGTCGGCCAGGTATGTTTTTTTAACTGATTAAAGTCTCTTTATTTCTTGCAAACAAGGCTAACATAACAAT
CCACAAGCTCTCGATACGACAAGTACCTATTCAAGACTAAGAATGGTGCTTCCGAAAAGAATGAGCCCGTCACAT
TCGATGAGCCCGTAAAATCTCACGTTTCTGCAGATTTTCTTCGTTTGGCATCCAAAAGAGAGCCTGTGGCTTCTC
CAGCCGCTGTCCAGTTAGACTCTTCACAATTGGAAGCTGTTCAGCAAGCCACCAAGCAAGAGCTCGCCATGATTC
AGGGCCCTCCAGGAACGGGCAAGACTTTTACCTCTGTGGTGACGATTGACAGTCATTTGAGAACCATGGAGGCTT
GTCATCCCACAAATGACGCTCCACCACCCATCATAGTGGTGGCTGAAACAAACCATGCATTGGACCAGCTCCTGA
CTCAATGTATGAGCGCAGGACTCAGGTCCATACTACGTCTTGGCCACAATGTCCAAGAAGACTCTGTGATCTACA
ACAAGTCTCTCTTGAAACTTCTCATGCGGTCAAGGGTGAAGCTGCCAGAAAAGAAAGCCGATGCCAAGTACAAGC
AAGCAGTCAAGGTGCTCACGTCTGACTTGAACCAAGTTTTCATGGATAAAGCCTTCTATGAGGCACAAGCGCTGC
ATGACGCTGAGCTCATTTCGCCGAAACAATACTTGTCGTTGATAGAAGACGACGGCTGGGAGACTGCCGACGCCC
AAGATAAACGAGGCCCTGTGGCAAAGTGGCTCAATCACTCCTCTGTTCAAAGCCAATGCGACCCACAACAGCCCG
TGAACAACACGATCCCACATGAGGGCGTTTTCCCAAACTATATCCCCTTTGGAGTATCTACGGCCAGAGGCCTAT
TGCGAAGCGTTGAGCGCGACGGAATAAATGACTGGGCGATCAGGGCTGTTCGCCTATTGGAATGCTCTTCTGATC
TTTATCAGATTCCCCTGTGGCAGAGACGACATATCTACTGCCTTCTTCATAAGCAGATGCAGGAACGCTCCATAC
AAAACCTTTTACAGGCCATCAAGGTATTTGATATTGAGTGCGAAGATTTCAAAAAGGCCAGATCGGTCAATGATG
CGGCCGTTATTCGTGGAGAAGACATTCGCATCATTGGCTGCACTACTACTGGCTTGGCCAAGTATCGCCGTCTCC
TTGAAATCCTGAAGCCTCGAATTTTGTTGGTGGAAGAGGCGGCAGAGGTGCGCGAAGGCAGTATCGTGGCAGGAT
TGATGCCTTGCATCGAGCAACTTGTCTTGGTTGGAGACCACCAACAATTGATACCTAGCGTTGACGTTTGGGAGC
TCAGCAGAAGCCCACATCGAATCGACATTTCCCTATTTGAGAGAATGGTCAAGCTCGAGGTGCCTTTTTGCTCGT
TGCGCGTCCAACGACGCATGGCTCCGGCTCTCCGGCGGGTGATGCAGTCTTTCTATCCTCATATCCAAGACCATG
CTAGCGTCAAGGAGCTACCTCTGGTGCCGGGCATGAGTTCGAGACGCCTCTGGTGGTTTGATCACCAATGGGAAC
AGAGTCAGACAGTTGGGTGTTCGTTTGTAAACACGGAGGAAGCCGACATGATTGTTGGCTTCGTCGGTTACTTGA
TTCAGCATGGCATGTCGCCAAGCCGCATCACGGTGCTGGCATACTACAGTGGTCAAGTTGCCCTGATACAGAGGA
AGCTCAAGAGCCACCCAAACCTTGCCCGTTTTGACTTTGAGCGTTCGGTTCGCACCATTGATGGATTTCAGGGGG
AAGAAAACGATGTCATTTTGCTCTCGCTTGTGCGAGGCCCCGGAAGCGACGGCGGTCGGGGCAGGGTTGGGTTTT
TGGCTGACGAGAACCGAGCAGTTGTGGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail