Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|471
Gene name
LocationContig_107:32586..34122
Strand-
Gene length (bp)1536
Transcript length (bp)1461
Coding sequence length (bp)1461
Protein length (aa) 487

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05978 UNC-93 Ion channel regulatory protein UNC-93 7.7E-09 67 275

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9URX1|YLX5_SCHPO UNC93-like protein C922.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.05c PE=3 SV=1 26 408 3.0E-38
sp|Q8LG53|UN932_ARATH UNC93-like protein 2 OS=Arabidopsis thaliana GN=At1g18010 PE=2 SV=2 4 410 5.0E-34
sp|Q56WD3|UN931_ARATH UNC93-like protein 1 OS=Arabidopsis thaliana GN=At1g18000 PE=2 SV=2 4 410 5.0E-34
sp|O14237|YEL4_SCHPO Uncharacterized membrane protein C6F6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F6.04c PE=4 SV=1 31 407 1.0E-27

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 62 84 22
3 89 111 22
4 116 138 22
5 159 178 19
6 193 215 22
7 279 298 19
8 313 332 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|471
MATTSSNIHNGSPPALSSTQTKRQWYHTTLFNAIVIGAVGFLAPGLWNATNALGAGGAQEPYLINAANALVYTLM
GLLCILGGPIANRIGLARTLFFGAVGYPVYSAGLYANNRSGNVWLVLVGAAACGVSAGLFWASEGAVALGYPEPA
KRGRYMNIWLWFRTGGPLLGGAIVLALNNSAEAKSKGKVASQTYIIFIALQCLGPLAALLLSPPYKLQREDGTKI
IMRVEATLCAEIKALWRACVRRDILVLLPMFWAADFNQYNGNFLTYYFGIRARALVGFIINFGTLASSQIMSSLL
DYGRFPVSRRIQIGFYYAIAVNAVAWIYAWIIQAKYTAHAPSLDWQDRAFIEGFLVLLLWDFARQALQNWLYYYL
ATKTDNLADLTRFCGILRGQESFAQAVSFGLNTKKWHGGRVPMAVNSILLGAAAVSTAVAITSPNPPPECHEHGM
TAENQDSSQLGPWDALGKDGTLCLTCETNNKQGNFS*
Coding >OphauB2|471
ATGGCCACCACGAGCTCCAATATACACAATGGCTCGCCTCCCGCCTTGTCCTCGACCCAAACCAAGCGCCAATGG
TACCACACAACCCTCTTCAACGCCATCGTCATTGGAGCCGTTGGCTTTCTCGCCCCCGGCCTCTGGAATGCCACC
AACGCCCTCGGCGCAGGCGGCGCCCAAGAACCCTACCTCATCAACGCTGCCAACGCCCTCGTCTACACCCTCATG
GGCCTCTTGTGTATCCTCGGCGGCCCCATTGCCAACCGCATTGGCCTTGCCCGCACCCTATTTTTCGGTGCCGTG
GGATACCCCGTCTACTCGGCCGGCCTATATGCCAATAACCGCTCCGGCAATGTCTGGCTTGTGCTTGTTGGCGCA
GCAGCATGCGGCGTCTCGGCCGGTCTGTTTTGGGCGTCCGAGGGCGCTGTTGCGCTGGGATACCCCGAGCCGGCA
AAACGAGGCCGCTACATGAATATCTGGCTCTGGTTTCGCACCGGCGGGCCCTTGCTCGGCGGCGCCATTGTTTTG
GCACTCAACAACAGCGCCGAGGCCAAGAGCAAGGGCAAAGTTGCTTCGCAGACGTACATCATCTTCATCGCCCTG
CAGTGCTTGGGCCCCTTGGCCGCGCTGCTTCTCTCCCCGCCCTACAAGCTCCAGCGCGAAGACGGCACCAAAATC
ATCATGAGGGTCGAGGCCACCTTGTGCGCCGAGATCAAGGCCCTGTGGCGCGCCTGCGTGCGCAGAGACATTCTT
GTCCTGCTTCCAATGTTTTGGGCCGCCGATTTCAACCAGTACAATGGCAACTTTTTGACCTATTACTTTGGCATC
CGTGCTCGTGCCCTGGTGGGCTTCATCATCAACTTTGGTACCCTCGCTTCTTCGCAAATCATGAGCAGCCTGCTC
GACTATGGCCGCTTTCCCGTTTCTCGCCGCATCCAGATTGGCTTTTACTACGCTATTGCTGTCAATGCGGTTGCT
TGGATCTATGCCTGGATCATACAGGCCAAGTACACGGCTCATGCTCCATCACTCGACTGGCAGGACCGCGCCTTT
ATCGAGGGCTTCCTTGTCCTCTTGCTGTGGGACTTTGCTCGCCAGGCCTTGCAGAATTGGCTCTACTACTACCTC
GCAACCAAAACAGACAACCTTGCCGACTTGACTCGCTTCTGCGGCATCCTGCGCGGACAGGAAAGCTTTGCGCAG
GCAGTCAGCTTTGGCCTCAATACCAAAAAGTGGCATGGCGGTAGAGTCCCCATGGCAGTCAATTCCATACTTCTT
GGAGCCGCGGCTGTTTCAACTGCTGTAGCCATAACGAGTCCCAATCCACCGCCCGAGTGCCATGAGCATGGCATG
ACTGCTGAGAACCAAGATTCCAGCCAACTCGGGCCTTGGGATGCCCTGGGCAAAGACGGAACGCTATGCTTGACT
TGTGAGACCAACAATAAGCAGGGCAATTTCTCGTAA
Transcript >OphauB2|471
ATGGCCACCACGAGCTCCAATATACACAATGGCTCGCCTCCCGCCTTGTCCTCGACCCAAACCAAGCGCCAATGG
TACCACACAACCCTCTTCAACGCCATCGTCATTGGAGCCGTTGGCTTTCTCGCCCCCGGCCTCTGGAATGCCACC
AACGCCCTCGGCGCAGGCGGCGCCCAAGAACCCTACCTCATCAACGCTGCCAACGCCCTCGTCTACACCCTCATG
GGCCTCTTGTGTATCCTCGGCGGCCCCATTGCCAACCGCATTGGCCTTGCCCGCACCCTATTTTTCGGTGCCGTG
GGATACCCCGTCTACTCGGCCGGCCTATATGCCAATAACCGCTCCGGCAATGTCTGGCTTGTGCTTGTTGGCGCA
GCAGCATGCGGCGTCTCGGCCGGTCTGTTTTGGGCGTCCGAGGGCGCTGTTGCGCTGGGATACCCCGAGCCGGCA
AAACGAGGCCGCTACATGAATATCTGGCTCTGGTTTCGCACCGGCGGGCCCTTGCTCGGCGGCGCCATTGTTTTG
GCACTCAACAACAGCGCCGAGGCCAAGAGCAAGGGCAAAGTTGCTTCGCAGACGTACATCATCTTCATCGCCCTG
CAGTGCTTGGGCCCCTTGGCCGCGCTGCTTCTCTCCCCGCCCTACAAGCTCCAGCGCGAAGACGGCACCAAAATC
ATCATGAGGGTCGAGGCCACCTTGTGCGCCGAGATCAAGGCCCTGTGGCGCGCCTGCGTGCGCAGAGACATTCTT
GTCCTGCTTCCAATGTTTTGGGCCGCCGATTTCAACCAGTACAATGGCAACTTTTTGACCTATTACTTTGGCATC
CGTGCTCGTGCCCTGGTGGGCTTCATCATCAACTTTGGTACCCTCGCTTCTTCGCAAATCATGAGCAGCCTGCTC
GACTATGGCCGCTTTCCCGTTTCTCGCCGCATCCAGATTGGCTTTTACTACGCTATTGCTGTCAATGCGGTTGCT
TGGATCTATGCCTGGATCATACAGGCCAAGTACACGGCTCATGCTCCATCACTCGACTGGCAGGACCGCGCCTTT
ATCGAGGGCTTCCTTGTCCTCTTGCTGTGGGACTTTGCTCGCCAGGCCTTGCAGAATTGGCTCTACTACTACCTC
GCAACCAAAACAGACAACCTTGCCGACTTGACTCGCTTCTGCGGCATCCTGCGCGGACAGGAAAGCTTTGCGCAG
GCAGTCAGCTTTGGCCTCAATACCAAAAAGTGGCATGGCGGTAGAGTCCCCATGGCAGTCAATTCCATACTTCTT
GGAGCCGCGGCTGTTTCAACTGCTGTAGCCATAACGAGTCCCAATCCACCGCCCGAGTGCCATGAGCATGGCATG
ACTGCTGAGAACCAAGATTCCAGCCAACTCGGGCCTTGGGATGCCCTGGGCAAAGACGGAACGCTATGCTTGACT
TGTGAGACCAACAATAAGCAGGGCAATTTCTCGTAA
Gene >OphauB2|471
ATGGCCACCACGAGCTCCAATATACACAATGGCTCGCCTCCCGCCTTGTCCTCGACCCAAACCAAGCGCCAATGG
TACCACACAACCCTCTTCAACGCCATCGTCATTGGAGCCGTTGGCTTTCTCGCCCCCGGCCTCTGGAATGCCACC
AACGCCCTCGGCGCAGGCGGCGCCCAAGAACCCTACCTCATCAACGCTGCCAACGCCCTCGTCTACACCCTCATG
GGCCTCTTGTGTATCCTCGGCGGCCCCATTGCCAACCGCATTGGCCTTGCCCGCACCCTATTTTTCGGTGCCGTG
GGATACCCCGTCTACTCGGCCGGCCTATATGCCAATAACCGCTCCGGCAATGTCTGGCTTGTGCTTGTTGGCGCA
GCAGCATGCGGCGTCTCGGCCGGTCTGTTTTGGGCGTCCGAGGGCGCTGTTGCGCTGGGATACCCCGAGCCGGCA
AAACGAGGCCGCTACATGAATATCTGGCTCTGGTTTCGCACCGGCGGGCCCTTGCTCGGCGGCGCCATTGTTTTG
GCACTCAACAACAGCGCCGAGGCCAAGAGCAAGGGCAAAGTTGCTTCGCAGACGTACATCATCTTCATCGCCCTG
CAGTGCTTGGGCCCCTTGGCCGCGCTGCTTCTCTCCCCGCCCTACAAGCTCCAGCGCGAAGACGGCACCAAAATC
ATCATGAGGGTCGAGGCCACCTTGTGCGCCGAGATCAAGGCCCTGTGGCGCGCCTGCGTGCGCAGAGACATTCTT
GTCCTGCTTCCAATGTTTTGGGCCGCCGATTTCAACCAGTACAATGGCAACTTTTTGACCTATTACTTTGGCATC
CGTGCTCGTGCCCTGGTGGGCTTCATCATCAACTTTGGTACCCTCGCTTCTTCGCAAATCATGAGCAGCCTGCTC
GACTATGGCCGCTTTCCCGTTTCTCGCCGCATCCAGATTGGCTTTTACTACGCTATTGCTGTCAATGCGGTTGCT
TGGATCTATGCCTGGATCATACAGGCCAAGTACACGGCTCATGCTCCATCACTCGACTGGCAGGACCGCGCCTTT
ATCGAGGGCTTCCTTGTCCTCTTGCTGTGGGACTTTGCTCGCCAGGCCTTGCAGAATTGGCTCTACTACTACCTC
GCAACCAAAACAGACAACCTTGCCGACTTGACTCGCTTCTGCGGCATCCTGCGCGGACAGGAAAGCTTTGCGCAG
GCAGTCAGCTTTGGCCTCAATACCAAAAAGTGGCATGGCGGTAGAGTCCCCATGGCAGTCAATTCCATACTTCTT
GGTAGATGCTCCCCCTGGACCCAATCTTACCCCTCGTGTTTTTTTTCTTTTGCAAGTAGTATCTCACAGGGTATA
GGAGCCGCGGCTGTTTCAACTGCTGTAGCCATAACGAGTCCCAATCCACCGCCCGAGTGCCATGAGCATGGCATG
ACTGCTGAGAACCAAGATTCCAGCCAACTCGGGCCTTGGGATGCCCTGGGCAAAGACGGAACGCTATGCTTGACT
TGTGAGACCAACAATAAGCAGGGCAATTTCTCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail