Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|47
Gene name
LocationContig_1:110799..111497
Strand-
Gene length (bp)698
Transcript length (bp)639
Coding sequence length (bp)639
Protein length (aa) 213

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06912 DUF1275 Protein of unknown function (DUF1275) 4.1E-23 88 198

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 33 55 22
3 62 84 22
4 99 121 22
5 159 176 17
6 181 203 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|47
MQTGNTVYVGLGIASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XAAAIVTFAPPPPPSAAPEQDDTLHWTVLVPLALVALQSCGQAVTSRALRFNALTSVVLTSIYCDLFSDADLFAV
RNVERNRRAAAPLLLLLGAIVGGWFAHSSVGIAGALWTAAVLKLAIVVLWFVWPAQADDDQD*
Coding >OphauB2|47
ATGCAGACCGGAAACACCGTCTATGTCGGCCTCGGCATTGCCTCGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NTTGCTGCCGCCATTGTCACCTTTGCGCCCCCGCCGCCTCCCTCCGCGGCTCCCGAGCAAGACGACACGCTCCAC
TGGACCGTCCTCGTTCCTCTTGCCCTCGTTGCGCTCCAGAGCTGTGGCCAGGCCGTCACCAGCCGCGCCCTAAGG
TTCAATGCCCTGACGAGTGTTGTTCTGACCAGCATCTACTGCGACTTGTTCTCCGATGCCGACCTATTTGCCGTG
CGAAACGTCGAGCGTAACCGCCGCGCCGCTGCTCCTCTGCTACTCCTGCTCGGAGCCATTGTTGGCGGTTGGTTT
GCCCATAGCTCCGTGGGCATAGCCGGAGCCTTGTGGACAGCTGCTGTCCTCAAGCTGGCCATTGTTGTCTTGTGG
TTTGTTTGGCCAGCCCAAGCCGACGACGACCAAGACTAG
Transcript >OphauB2|47
ATGCAGACCGGAAACACCGTCTATGTCGGCCTCGGCATTGCCTCGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NTTGCTGCCGCCATTGTCACCTTTGCGCCCCCGCCGCCTCCCTCCGCGGCTCCCGAGCAAGACGACACGCTCCAC
TGGACCGTCCTCGTTCCTCTTGCCCTCGTTGCGCTCCAGAGCTGTGGCCAGGCCGTCACCAGCCGCGCCCTAAGG
TTCAATGCCCTGACGAGTGTTGTTCTGACCAGCATCTACTGCGACTTGTTCTCCGATGCCGACCTATTTGCCGTG
CGAAACGTCGAGCGTAACCGCCGCGCCGCTGCTCCTCTGCTACTCCTGCTCGGAGCCATTGTTGGCGGTTGGTTT
GCCCATAGCTCCGTGGGCATAGCCGGAGCCTTGTGGACAGCTGCTGTCCTCAAGCTGGCCATTGTTGTCTTGTGG
TTTGTTTGGCCAGCCCAAGCCGACGACGACCAAGACTAG
Gene >OphauB2|47
ATGCAGACCGGTCAGCCAGCGTCAGCGTTACACGGCATGCACATGGCCCGGCTGACTGAGTCAATGCAGGAAACA
CCGTCTATGTCGGCCTCGGCATTGCCTCGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGCTGCCGCCATTG
TCACCTTTGCGCCCCCGCCGCCTCCCTCCGCGGCTCCCGAGCAAGACGACACGCTCCACTGGACCGTCCTCGTTC
CTCTTGCCCTCGTTGCGCTCCAGAGCTGTGGCCAGGCCGTCACCAGCCGCGCCCTAAGGTTCAATGCCCTGACGA
GTGTTGTTCTGACCAGCATCTACTGCGACTTGTTCTCCGATGCCGACCTATTTGCCGTGCGAAACGTCGAGCGTA
ACCGCCGCGCCGCTGCTCCTCTGCTACTCCTGCTCGGAGCCATTGTTGGCGGTTGGTTTGCCCATAGCTCCGTGG
GCATAGCCGGAGCCTTGTGGACAGCTGCTGTCCTCAAGCTGGCCATTGTTGTCTTGTGGTTTGTTTGGCCAGCCC
AAGCCGACGACGACCAAGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail