Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4691
Gene name
LocationContig_32:27154..29317
Strand+
Gene length (bp)2163
Transcript length (bp)2163
Coding sequence length (bp)2163
Protein length (aa) 721

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.8E-12 553 648
PF13637 Ank_4 Ankyrin repeats (many copies) 6.3E-08 584 637
PF00023 Ank Ankyrin repeat 2.7E-02 652 684

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 543 693 1.0E-10
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 543 693 8.0E-10
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 543 714 8.0E-10
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 546 714 3.0E-09
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 546 705 4.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 543 693 1.0E-10
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 543 693 8.0E-10
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 543 714 8.0E-10
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 546 714 3.0E-09
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 546 705 4.0E-09
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 546 720 9.0E-09
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 546 720 9.0E-09
sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 447 702 2.0E-08
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 540 713 2.0E-08
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 553 714 2.0E-08
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 553 720 6.0E-08
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 553 713 7.0E-08
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 553 713 1.0E-07
sp|P31695|NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 533 693 2.0E-07
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 552 713 2.0E-07
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 548 689 3.0E-07
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 553 720 3.0E-07
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 553 720 3.0E-07
sp|Q99466|NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 533 693 3.0E-07
sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 447 702 4.0E-07
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 548 689 4.0E-07
sp|Q9QW30|NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 546 702 4.0E-07
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 553 720 4.0E-07
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 542 696 5.0E-07
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 618 719 6.0E-07
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 543 693 8.0E-07
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 553 694 9.0E-07
sp|Q4ULZ2|Y580_RICFE Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 542 689 1.0E-06
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 552 693 1.0E-06
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 552 693 1.0E-06
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 553 714 2.0E-06
sp|Q14678|KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=KANK1 PE=1 SV=3 582 693 3.0E-06
sp|Q09YH1|ASZ1_SAIBB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 556 713 3.0E-06
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 546 693 3.0E-06
sp|Q09YK6|ASZ1_ATEGE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ateles geoffroyi GN=ASZ1 PE=3 SV=1 556 713 3.0E-06
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 546 693 4.0E-06
sp|Q09YN0|ASZ1_RABIT Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 556 713 4.0E-06
sp|O22265|SR43C_ARATH Signal recognition particle 43 kDa protein, chloroplastic OS=Arabidopsis thaliana GN=CAO PE=1 SV=2 571 694 7.0E-06
sp|Q2QLG0|ASZ1_CALJA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 556 713 7.0E-06
sp|Q2QLB5|ASZ1_CALMO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callicebus moloch GN=ASZ1 PE=3 SV=1 508 713 8.0E-06
sp|Q07DV3|ASZ1_AOTNA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 556 713 8.0E-06
sp|Q9R172|NOTC3_RAT Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus GN=Notch3 PE=2 SV=2 582 702 8.0E-06
sp|Q61982|NOTC3_MOUSE Neurogenic locus notch homolog protein 3 OS=Mus musculus GN=Notch3 PE=1 SV=1 582 702 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup84
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1577
Ophiocordyceps australis 1348a (Ghana) OphauG2|2943
Ophiocordyceps australis 1348a (Ghana) OphauG2|5919
Ophiocordyceps australis map64 (Brazil) OphauB2|1448
Ophiocordyceps australis map64 (Brazil) OphauB2|1752
Ophiocordyceps australis map64 (Brazil) OphauB2|1755
Ophiocordyceps australis map64 (Brazil) OphauB2|2666
Ophiocordyceps australis map64 (Brazil) OphauB2|4190
Ophiocordyceps australis map64 (Brazil) OphauB2|4691 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4872
Ophiocordyceps australis map64 (Brazil) OphauB2|5124
Ophiocordyceps australis map64 (Brazil) OphauB2|7730
Ophiocordyceps kimflemingae Ophio5|7512
Ophiocordyceps subramaniannii Hirsu2|1991
Ophiocordyceps subramaniannii Hirsu2|4897
Ophiocordyceps subramaniannii Hirsu2|7175

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4691
MADGLSPPKTPKGPMKKMPFCLGVPQKPAKIQDPTYKTGVTRDPNRPLGPLKKSMGVKKLAETMSQEEFSRLIQG
YGLKPKPANGNPISESTIFERFNSKVTAKSARRWARKWGVKGGLFTLASLPDYLKDLNDMNQEDTTDLQKAAVLT
SIVPFFGCSVKAAADAKQGRLNVFETVLCHVSDGIMFTPIFPVSVIIKALTFLVDVFTKVFRLTDIGYIKDERAK
GWQNQFNEMKKVISSDKYISDQQNKYTAKISAHLYVLAAQKGYLYAGWMKATQNATNSGDNIQEIAKKLNEDWKK
VQEEARAKIQATEKHFKKEIPERIGKSTGYGSIKYYARYNLEYQTYTDKDLIRRSKKGMPSWMKTWFKNRYNGNF
DALESSKRTIKSPDLKNDVSEARKIAEQSAKKIVQPDLGVLKGEPQDLIVEVPYPADEADKECPGGYWDPDTREC
WPSPEGPTTDGPPKPSEKEDGAKAGKECSDGYWDPDTRECWPSPEGPTVDGPPKPSKGADSNKAEKECSDGYWDP
DTRECWPSPEWPTINIPDTPDKDMQLELWEAAYSGDTAAMKEILSSGKVNPDVAIMGQSPLVRAASGESEDAVKL
LLRTKKVNVNSVDSDDGRTALIKAAFFRSPKIVKRLLDTGKVDVNVKDKREGRTALAWAAFQGDIDSVKALLATG
KVDVNIKDNQGKTPAQLAKMAWSWFASTGKKGLIVQLLNDYKGPN*
Coding >OphauB2|4691
ATGGCGGACGGCCTCTCGCCGCCCAAGACGCCCAAGGGGCCGATGAAAAAGATGCCCTTTTGTCTCGGCGTGCCT
CAGAAGCCGGCCAAGATACAGGACCCGACCTATAAGACCGGAGTGACGAGAGACCCAAACCGTCCACTGGGGCCG
CTTAAGAAGAGCATGGGAGTGAAAAAGCTAGCCGAAACAATGTCGCAGGAGGAGTTTTCACGACTCATCCAGGGC
TATGGACTCAAGCCCAAGCCGGCCAATGGTAATCCAATCTCAGAAAGCACCATTTTTGAAAGGTTCAATAGCAAA
GTCACTGCGAAATCAGCGAGGCGATGGGCGAGGAAGTGGGGTGTCAAGGGAGGCTTGTTTACCCTTGCCAGTCTA
CCCGATTATCTCAAGGACTTGAACGACATGAACCAAGAGGACACGACCGACTTGCAGAAAGCCGCTGTACTTACC
TCCATTGTGCCTTTCTTCGGCTGCTCCGTGAAGGCCGCGGCGGATGCCAAGCAGGGCCGACTAAACGTATTCGAA
ACCGTCTTGTGCCATGTCAGCGACGGCATAATGTTCACACCAATATTTCCAGTCTCTGTGATTATCAAGGCCTTG
ACTTTTCTTGTCGATGTCTTTACTAAGGTTTTCAGACTAACCGACATCGGTTATATTAAAGACGAGCGCGCTAAA
GGGTGGCAAAATCAATTCAACGAGATGAAAAAGGTCATTTCATCCGATAAATATATATCCGATCAGCAAAACAAA
TACACCGCCAAGATTTCAGCCCACTTGTATGTGCTGGCAGCACAAAAAGGGTATTTATATGCCGGTTGGATGAAA
GCAACGCAAAATGCCACGAATAGCGGTGACAACATCCAAGAAATCGCCAAGAAACTCAATGAGGACTGGAAAAAA
GTTCAAGAGGAGGCGCGCGCCAAGATTCAAGCAACAGAGAAGCACTTCAAGAAGGAAATTCCAGAAAGGATAGGC
AAGAGTACGGGATACGGCAGCATAAAATATTATGCCAGATATAATCTGGAATATCAAACATATACAGACAAGGAC
CTGATTCGAAGGTCAAAAAAAGGTATGCCAAGCTGGATGAAGACGTGGTTCAAAAACAGGTACAATGGCAATTTC
GACGCACTTGAGAGTTCCAAGAGGACAATAAAGTCACCGGATCTAAAGAACGATGTATCGGAAGCCAGGAAGATC
GCCGAGCAGTCTGCTAAGAAGATTGTGCAACCTGACCTGGGCGTACTCAAAGGCGAGCCTCAGGACTTGATTGTG
GAAGTGCCATATCCAGCTGATGAGGCGGACAAGGAGTGTCCGGGTGGCTACTGGGACCCAGACACGCGCGAGTGC
TGGCCTTCTCCCGAGGGGCCCACGACCGACGGCCCGCCGAAGCCGTCGGAGAAAGAAGACGGTGCAAAGGCGGGC
AAGGAGTGTTCGGACGGCTACTGGGACCCGGACACGCGCGAGTGCTGGCCGTCTCCTGAAGGACCCACGGTCGAC
GGCCCGCCGAAGCCATCAAAGGGGGCAGATAGTAACAAGGCGGAGAAGGAGTGCTCGGACGGCTACTGGGACCCG
GATACGCGCGAATGCTGGCCGTCGCCCGAGTGGCCCACCATCAACATCCCGGACACGCCCGACAAGGACATGCAA
CTAGAGCTATGGGAAGCGGCTTATAGCGGCGATACCGCGGCCATGAAAGAAATCCTCTCGTCGGGCAAGGTCAAC
CCAGACGTGGCGATAATGGGACAGTCGCCGCTCGTGCGGGCGGCATCAGGCGAGAGCGAGGATGCCGTCAAGCTC
CTACTTCGCACGAAAAAAGTCAATGTCAACTCGGTGGACAGCGACGACGGGAGGACGGCCTTGATCAAGGCGGCC
TTCTTCCGCTCCCCCAAGATCGTCAAGAGGCTGCTCGACACGGGGAAAGTAGATGTCAACGTCAAGGACAAGCGG
GAGGGGCGGACGGCGCTGGCGTGGGCGGCTTTCCAGGGAGACATTGACTCGGTCAAGGCTTTGCTCGCCACAGGC
AAGGTGGACGTCAACATCAAAGACAATCAGGGGAAGACGCCGGCGCAGCTAGCAAAAATGGCTTGGAGCTGGTTT
GCGAGTACTGGCAAGAAAGGCCTCATCGTGCAGCTGCTTAACGATTATAAGGGGCCTAATTAA
Transcript >OphauB2|4691
ATGGCGGACGGCCTCTCGCCGCCCAAGACGCCCAAGGGGCCGATGAAAAAGATGCCCTTTTGTCTCGGCGTGCCT
CAGAAGCCGGCCAAGATACAGGACCCGACCTATAAGACCGGAGTGACGAGAGACCCAAACCGTCCACTGGGGCCG
CTTAAGAAGAGCATGGGAGTGAAAAAGCTAGCCGAAACAATGTCGCAGGAGGAGTTTTCACGACTCATCCAGGGC
TATGGACTCAAGCCCAAGCCGGCCAATGGTAATCCAATCTCAGAAAGCACCATTTTTGAAAGGTTCAATAGCAAA
GTCACTGCGAAATCAGCGAGGCGATGGGCGAGGAAGTGGGGTGTCAAGGGAGGCTTGTTTACCCTTGCCAGTCTA
CCCGATTATCTCAAGGACTTGAACGACATGAACCAAGAGGACACGACCGACTTGCAGAAAGCCGCTGTACTTACC
TCCATTGTGCCTTTCTTCGGCTGCTCCGTGAAGGCCGCGGCGGATGCCAAGCAGGGCCGACTAAACGTATTCGAA
ACCGTCTTGTGCCATGTCAGCGACGGCATAATGTTCACACCAATATTTCCAGTCTCTGTGATTATCAAGGCCTTG
ACTTTTCTTGTCGATGTCTTTACTAAGGTTTTCAGACTAACCGACATCGGTTATATTAAAGACGAGCGCGCTAAA
GGGTGGCAAAATCAATTCAACGAGATGAAAAAGGTCATTTCATCCGATAAATATATATCCGATCAGCAAAACAAA
TACACCGCCAAGATTTCAGCCCACTTGTATGTGCTGGCAGCACAAAAAGGGTATTTATATGCCGGTTGGATGAAA
GCAACGCAAAATGCCACGAATAGCGGTGACAACATCCAAGAAATCGCCAAGAAACTCAATGAGGACTGGAAAAAA
GTTCAAGAGGAGGCGCGCGCCAAGATTCAAGCAACAGAGAAGCACTTCAAGAAGGAAATTCCAGAAAGGATAGGC
AAGAGTACGGGATACGGCAGCATAAAATATTATGCCAGATATAATCTGGAATATCAAACATATACAGACAAGGAC
CTGATTCGAAGGTCAAAAAAAGGTATGCCAAGCTGGATGAAGACGTGGTTCAAAAACAGGTACAATGGCAATTTC
GACGCACTTGAGAGTTCCAAGAGGACAATAAAGTCACCGGATCTAAAGAACGATGTATCGGAAGCCAGGAAGATC
GCCGAGCAGTCTGCTAAGAAGATTGTGCAACCTGACCTGGGCGTACTCAAAGGCGAGCCTCAGGACTTGATTGTG
GAAGTGCCATATCCAGCTGATGAGGCGGACAAGGAGTGTCCGGGTGGCTACTGGGACCCAGACACGCGCGAGTGC
TGGCCTTCTCCCGAGGGGCCCACGACCGACGGCCCGCCGAAGCCGTCGGAGAAAGAAGACGGTGCAAAGGCGGGC
AAGGAGTGTTCGGACGGCTACTGGGACCCGGACACGCGCGAGTGCTGGCCGTCTCCTGAAGGACCCACGGTCGAC
GGCCCGCCGAAGCCATCAAAGGGGGCAGATAGTAACAAGGCGGAGAAGGAGTGCTCGGACGGCTACTGGGACCCG
GATACGCGCGAATGCTGGCCGTCGCCCGAGTGGCCCACCATCAACATCCCGGACACGCCCGACAAGGACATGCAA
CTAGAGCTATGGGAAGCGGCTTATAGCGGCGATACCGCGGCCATGAAAGAAATCCTCTCGTCGGGCAAGGTCAAC
CCAGACGTGGCGATAATGGGACAGTCGCCGCTCGTGCGGGCGGCATCAGGCGAGAGCGAGGATGCCGTCAAGCTC
CTACTTCGCACGAAAAAAGTCAATGTCAACTCGGTGGACAGCGACGACGGGAGGACGGCCTTGATCAAGGCGGCC
TTCTTCCGCTCCCCCAAGATCGTCAAGAGGCTGCTCGACACGGGGAAAGTAGATGTCAACGTCAAGGACAAGCGG
GAGGGGCGGACGGCGCTGGCGTGGGCGGCTTTCCAGGGAGACATTGACTCGGTCAAGGCTTTGCTCGCCACAGGC
AAGGTGGACGTCAACATCAAAGACAATCAGGGGAAGACGCCGGCGCAGCTAGCAAAAATGGCTTGGAGCTGGTTT
GCGAGTACTGGCAAGAAAGGCCTCATCGTGCAGCTGCTTAACGATTATAAGGGGCCTAATTAA
Gene >OphauB2|4691
ATGGCGGACGGCCTCTCGCCGCCCAAGACGCCCAAGGGGCCGATGAAAAAGATGCCCTTTTGTCTCGGCGTGCCT
CAGAAGCCGGCCAAGATACAGGACCCGACCTATAAGACCGGAGTGACGAGAGACCCAAACCGTCCACTGGGGCCG
CTTAAGAAGAGCATGGGAGTGAAAAAGCTAGCCGAAACAATGTCGCAGGAGGAGTTTTCACGACTCATCCAGGGC
TATGGACTCAAGCCCAAGCCGGCCAATGGTAATCCAATCTCAGAAAGCACCATTTTTGAAAGGTTCAATAGCAAA
GTCACTGCGAAATCAGCGAGGCGATGGGCGAGGAAGTGGGGTGTCAAGGGAGGCTTGTTTACCCTTGCCAGTCTA
CCCGATTATCTCAAGGACTTGAACGACATGAACCAAGAGGACACGACCGACTTGCAGAAAGCCGCTGTACTTACC
TCCATTGTGCCTTTCTTCGGCTGCTCCGTGAAGGCCGCGGCGGATGCCAAGCAGGGCCGACTAAACGTATTCGAA
ACCGTCTTGTGCCATGTCAGCGACGGCATAATGTTCACACCAATATTTCCAGTCTCTGTGATTATCAAGGCCTTG
ACTTTTCTTGTCGATGTCTTTACTAAGGTTTTCAGACTAACCGACATCGGTTATATTAAAGACGAGCGCGCTAAA
GGGTGGCAAAATCAATTCAACGAGATGAAAAAGGTCATTTCATCCGATAAATATATATCCGATCAGCAAAACAAA
TACACCGCCAAGATTTCAGCCCACTTGTATGTGCTGGCAGCACAAAAAGGGTATTTATATGCCGGTTGGATGAAA
GCAACGCAAAATGCCACGAATAGCGGTGACAACATCCAAGAAATCGCCAAGAAACTCAATGAGGACTGGAAAAAA
GTTCAAGAGGAGGCGCGCGCCAAGATTCAAGCAACAGAGAAGCACTTCAAGAAGGAAATTCCAGAAAGGATAGGC
AAGAGTACGGGATACGGCAGCATAAAATATTATGCCAGATATAATCTGGAATATCAAACATATACAGACAAGGAC
CTGATTCGAAGGTCAAAAAAAGGTATGCCAAGCTGGATGAAGACGTGGTTCAAAAACAGGTACAATGGCAATTTC
GACGCACTTGAGAGTTCCAAGAGGACAATAAAGTCACCGGATCTAAAGAACGATGTATCGGAAGCCAGGAAGATC
GCCGAGCAGTCTGCTAAGAAGATTGTGCAACCTGACCTGGGCGTACTCAAAGGCGAGCCTCAGGACTTGATTGTG
GAAGTGCCATATCCAGCTGATGAGGCGGACAAGGAGTGTCCGGGTGGCTACTGGGACCCAGACACGCGCGAGTGC
TGGCCTTCTCCCGAGGGGCCCACGACCGACGGCCCGCCGAAGCCGTCGGAGAAAGAAGACGGTGCAAAGGCGGGC
AAGGAGTGTTCGGACGGCTACTGGGACCCGGACACGCGCGAGTGCTGGCCGTCTCCTGAAGGACCCACGGTCGAC
GGCCCGCCGAAGCCATCAAAGGGGGCAGATAGTAACAAGGCGGAGAAGGAGTGCTCGGACGGCTACTGGGACCCG
GATACGCGCGAATGCTGGCCGTCGCCCGAGTGGCCCACCATCAACATCCCGGACACGCCCGACAAGGACATGCAA
CTAGAGCTATGGGAAGCGGCTTATAGCGGCGATACCGCGGCCATGAAAGAAATCCTCTCGTCGGGCAAGGTCAAC
CCAGACGTGGCGATAATGGGACAGTCGCCGCTCGTGCGGGCGGCATCAGGCGAGAGCGAGGATGCCGTCAAGCTC
CTACTTCGCACGAAAAAAGTCAATGTCAACTCGGTGGACAGCGACGACGGGAGGACGGCCTTGATCAAGGCGGCC
TTCTTCCGCTCCCCCAAGATCGTCAAGAGGCTGCTCGACACGGGGAAAGTAGATGTCAACGTCAAGGACAAGCGG
GAGGGGCGGACGGCGCTGGCGTGGGCGGCTTTCCAGGGAGACATTGACTCGGTCAAGGCTTTGCTCGCCACAGGC
AAGGTGGACGTCAACATCAAAGACAATCAGGGGAAGACGCCGGCGCAGCTAGCAAAAATGGCTTGGAGCTGGTTT
GCGAGTACTGGCAAGAAAGGCCTCATCGTGCAGCTGCTTAACGATTATAAGGGGCCTAATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail