Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4679
Gene name
LocationContig_318:79..6026
Strand-
Gene length (bp)5947
Transcript length (bp)5814
Coding sequence length (bp)5814
Protein length (aa) 1938

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02364 Glucan_synthase 1,3-beta-glucan synthase component 0.0E+00 849 1672
PF14288 FKS1_dom1 1,3-beta-glucan synthase subunit FKS1, domain-1 4.2E-44 339 446

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38631|FKS1_YEAST 1,3-beta-glucan synthase component FKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKS1 PE=1 SV=2 29 1901 0.0E+00
sp|P40989|FKS2_YEAST 1,3-beta-glucan synthase component GSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSC2 PE=1 SV=2 16 1901 0.0E+00
sp|O74475|BGS4_SCHPO 1,3-beta-glucan synthase component bgs4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgs4 PE=1 SV=1 6 1891 0.0E+00
sp|O93927|FKS1_CRYNH 1,3-beta-glucan synthase component FKS1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=FKS1 PE=3 SV=3 155 1860 0.0E+00
sp|O13967|BGS2_SCHPO 1,3-beta-glucan synthase component bgs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgs2 PE=2 SV=2 54 1905 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38631|FKS1_YEAST 1,3-beta-glucan synthase component FKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKS1 PE=1 SV=2 29 1901 0.0E+00
sp|P40989|FKS2_YEAST 1,3-beta-glucan synthase component GSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSC2 PE=1 SV=2 16 1901 0.0E+00
sp|O74475|BGS4_SCHPO 1,3-beta-glucan synthase component bgs4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgs4 PE=1 SV=1 6 1891 0.0E+00
sp|O93927|FKS1_CRYNH 1,3-beta-glucan synthase component FKS1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=FKS1 PE=3 SV=3 155 1860 0.0E+00
sp|O13967|BGS2_SCHPO 1,3-beta-glucan synthase component bgs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgs2 PE=2 SV=2 54 1905 0.0E+00
sp|Q04952|FKS3_YEAST 1,3-beta-glucan synthase component FKS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKS3 PE=1 SV=1 193 1895 0.0E+00
sp|Q10287|BGS1_SCHPO 1,3-beta-glucan synthase component bgs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgs1 PE=1 SV=1 133 1887 0.0E+00
sp|Q9P377|BGS3_SCHPO 1,3-beta-glucan synthase component bgs3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgs3 PE=1 SV=1 193 1896 0.0E+00
sp|A2QLK4|FKS1_ASPNC 1,3-beta-glucan synthase component FKS1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fksA PE=3 SV=1 1 1921 0.0E+00
sp|Q9LXT9|CALS3_ARATH Callose synthase 3 OS=Arabidopsis thaliana GN=CALS3 PE=2 SV=3 851 1712 3.0E-101
sp|Q9SHJ3|CALS7_ARATH Callose synthase 7 OS=Arabidopsis thaliana GN=CALS7 PE=3 SV=3 851 1550 7.0E-97
sp|Q9AUE0|CALS1_ARATH Callose synthase 1 OS=Arabidopsis thaliana GN=CALS1 PE=1 SV=2 851 1550 2.0E-95
sp|Q9SFU6|CALS9_ARATH Callose synthase 9 OS=Arabidopsis thaliana GN=CALS9 PE=2 SV=2 851 1547 2.0E-95
sp|Q3B724|CALS5_ARATH Callose synthase 5 OS=Arabidopsis thaliana GN=CALS5 PE=1 SV=1 851 1548 4.0E-92
sp|Q9SJM0|CALSA_ARATH Callose synthase 10 OS=Arabidopsis thaliana GN=CALS10 PE=2 SV=5 851 1547 3.0E-91
sp|Q9SL03|CALS2_ARATH Callose synthase 2 OS=Arabidopsis thaliana GN=CALS2 PE=2 SV=3 851 1550 5.0E-91
sp|Q9LTG5|CALS4_ARATH Callose synthase 4 OS=Arabidopsis thaliana GN=CALS4 PE=3 SV=2 851 1551 8.0E-91
sp|Q9ZT82|CALSC_ARATH Callose synthase 12 OS=Arabidopsis thaliana GN=CALS12 PE=2 SV=1 851 1557 2.0E-90
sp|Q9LYS6|CALS6_ARATH Putative callose synthase 6 OS=Arabidopsis thaliana GN=CALS6 PE=3 SV=2 851 1547 5.0E-90
sp|Q9S9U0|CALSB_ARATH Callose synthase 11 OS=Arabidopsis thaliana GN=CALS11 PE=2 SV=1 851 1562 8.0E-88
sp|Q9LUD7|CALS8_ARATH Putative callose synthase 8 OS=Arabidopsis thaliana GN=CALS8 PE=2 SV=2 851 1547 3.0E-83
sp|Q3B724|CALS5_ARATH Callose synthase 5 OS=Arabidopsis thaliana GN=CALS5 PE=1 SV=1 211 498 1.0E-15
sp|Q9SJM0|CALSA_ARATH Callose synthase 10 OS=Arabidopsis thaliana GN=CALS10 PE=2 SV=5 188 501 2.0E-15
sp|Q9LYS6|CALS6_ARATH Putative callose synthase 6 OS=Arabidopsis thaliana GN=CALS6 PE=3 SV=2 343 501 2.0E-15
sp|Q9SFU6|CALS9_ARATH Callose synthase 9 OS=Arabidopsis thaliana GN=CALS9 PE=2 SV=2 203 501 5.0E-14
sp|Q9LXT9|CALS3_ARATH Callose synthase 3 OS=Arabidopsis thaliana GN=CALS3 PE=2 SV=3 206 494 1.0E-12
sp|Q9SL03|CALS2_ARATH Callose synthase 2 OS=Arabidopsis thaliana GN=CALS2 PE=2 SV=3 206 498 7.0E-12
sp|Q9LTG5|CALS4_ARATH Callose synthase 4 OS=Arabidopsis thaliana GN=CALS4 PE=3 SV=2 196 494 7.0E-12
sp|Q9ZT82|CALSC_ARATH Callose synthase 12 OS=Arabidopsis thaliana GN=CALS12 PE=2 SV=1 185 496 1.0E-11
sp|Q9AUE0|CALS1_ARATH Callose synthase 1 OS=Arabidopsis thaliana GN=CALS1 PE=1 SV=2 196 498 2.0E-11
sp|Q9LUD7|CALS8_ARATH Putative callose synthase 8 OS=Arabidopsis thaliana GN=CALS8 PE=2 SV=2 343 442 4.0E-10
sp|Q9SHJ3|CALS7_ARATH Callose synthase 7 OS=Arabidopsis thaliana GN=CALS7 PE=3 SV=3 350 495 2.0E-09
sp|Q9S9U0|CALSB_ARATH Callose synthase 11 OS=Arabidopsis thaliana GN=CALS11 PE=2 SV=1 343 478 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006075 (1->3)-beta-D-glucan biosynthetic process Yes
GO:0000148 1,3-beta-D-glucan synthase complex Yes
GO:0003843 1,3-beta-D-glucan synthase activity Yes
GO:0016020 membrane Yes
GO:0009059 macromolecule biosynthetic process No
GO:0016758 hexosyltransferase activity No
GO:0006074 (1->3)-beta-D-glucan metabolic process No
GO:0016051 carbohydrate biosynthetic process No
GO:0051273 beta-glucan metabolic process No
GO:1902494 catalytic complex No
GO:1990234 transferase complex No
GO:1901576 organic substance biosynthetic process No
GO:0016757 glycosyltransferase activity No
GO:0003674 molecular_function No
GO:0051274 beta-glucan biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0033692 cellular polysaccharide biosynthetic process No
GO:0005975 carbohydrate metabolic process No
GO:0006073 cellular glucan metabolic process No
GO:0005575 cellular_component No
GO:0005976 polysaccharide metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044264 cellular polysaccharide metabolic process No
GO:0009987 cellular process No
GO:0035251 UDP-glucosyltransferase activity No
GO:0016740 transferase activity No
GO:0008194 UDP-glycosyltransferase activity No
GO:0044262 cellular carbohydrate metabolic process No
GO:0098796 membrane protein complex No
GO:0009058 biosynthetic process No
GO:0032991 protein-containing complex No
GO:0044238 primary metabolic process No
GO:0009250 glucan biosynthetic process No
GO:0034637 cellular carbohydrate biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0008152 metabolic process No
GO:0046527 glucosyltransferase activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0044042 glucan metabolic process No
GO:0003824 catalytic activity No
GO:0098797 plasma membrane protein complex No
GO:0000271 polysaccharide biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 493 515 22
2 535 557 22
3 572 591 19
4 604 626 22
5 659 681 22
6 716 738 22
7 1336 1358 22
8 1395 1412 17
9 1504 1526 22
10 1597 1619 22
11 1641 1663 22
12 1683 1705 22
13 1715 1737 22
14 1784 1803 19
15 1840 1862 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT48 0.0E+00 849 1626

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6036
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6385
Ophiocordyceps australis map64 (Brazil) OphauB2|4679 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01782
Ophiocordyceps camponoti-rufipedis Ophun1|3249
Ophiocordyceps subramaniannii Hirsu2|151

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4679
MSGYPGGHHDQYDDGYAHQGGATDSYYQDDQYYDNSYDARGGHNGQAAHAGDGYYDESGYYNADPNNPYHQDGGY
YDGHDQYQDEYYNGQSGYYDQDYSNAYAGHTGRHGSEEDSETFSDFTMRSDMARAAEMDYYGRGDERHNSYGDGQ
RGYRPPSSQISYGANRSSGASTPNYGMDYGNVLPAGQRSREPYPAWTSDAQIPLSKEEIEDIFLDLTAKFGFQRD
SMRNMYDHLMTLLDSRASRMTPNQALLSLHADYIGGENANYRKWYFAAHLDLDDAVGFANAKSKGLRRKAKNKKK
KGDAANEAEALQDLEGDDSLEAAEYRWKTRMNRMSQHDRVRQIALYLLCWGEANQVRFMPECLCFIFKCADDYLN
SPACQALVEPVDEFTYLNNVITPLYQYVRDQGYEILNGVYVRRERDHKHIIGYDDCNQLFWYPEGIERVVLQDKS
KLVDVPPAERYLKLKDVNWKKCFFKTYKETRSWFHLLVNFNRIWIIHLTMFWFYTSHNAPTLLVGSKYEQQVNNQ
PPGSKQFSVVAFGGALAALIQILATLAEWAYVPRRWAGAQHLTKRLLFLIVIFIINVGPGVKVFMIPTDKKKTGV
DIDLIIGIVHFVIAIITFLFFAVMPLGGLFGSYLTKNSRRYVASQTFTASYPRLSGNDMAMSYGLWLTVFGAKFG
ESYVYLTLSFRDVIRYLSIFHPRCLGDKIIGKILCENHPYILLGLMFFTDLIFFFLDTYLFYVLLATIFSIARSF
YIGSSIWTPWRNIFSRLPKRIYSKILATTDMEIKYKPKVLISQVWNAIVISMYREHLLAIDHVQKLLYHQVPSEQ
EGKRTLRAPTFFVSQEDHSFKTEFFPSHSEAERRISFFAQSLSTPIPEPLPVDNMPTFTVMIPHYSEKILLSLRE
IIREDEPYSRVTLLEYLKQLHPHEWDCFVKDTKILADETSQMNGDLEKNEKDAAKSKIDDLPFYCIGFKSSAPEY
TLRTRIWASLRSQTLYRTVSGFMNYSRAIKLLYRVENPEVVQMFGGNSDKLERELERMARRKFKIVVSMQRYSKF
KKEEMENAEFLLRAYPDLQIAYLDEEPPVAEGEEPRLYSALIDGHSELMENGMRRPKFRIQLSGNPVLGDGKSDN
QNHSLIFYRGEYIQLIDANQDNYLEECLKIRSVLAEFEEMKMENISPYTPGIKNETSAPVAILGAREYIFSENIG
ILGDVAAGKEQTFGTLFARTLAQIGGKLHYGHPDFLNGIFMTTRGGVSKAQKGLHLNEDIFAGMNAILRGGRIKH
CEYYQCGKGRDLGFGSILNFTTKIGTGMGEQMLSREYYYLGTQLPLDRFLSFYYAHPGFHINNMFILLSVQLFML
TLLNFGAFKHETVRCDYNRNKPLTDPLFPTGCANTDAVMDWVQRSIFSIFFVFFLSFVPLIVQELTERGVWRALV
RFLKQFFSLSPFFEVFVCQIYANSVQQDLSFGGARYIGTGRGFATARIPFGVLYSRFAGPSIYFGARLLMMLLFA
TVTAWQAALVYFWITLLGLTISPFLYNPHQFAWNDFFIDYRDFLRWLSRGNSRSHASSWIAFCRLSRTRITGYKR
KTLGEASAKMSADVPRAAIANIFFTEILTPLLQVVWTLIPYLFINAQTGVLPSNNRGAKVQPTDSLIRVLLVSLA
PIGINAGVLGVMFFMACFMGPVLSMCCKKFGSVLAAVAHGAAVVFMLIFFEAMFVLEGFNFARTMAGMIAVVAIQ
RFIFKLIVSLALTREMKTDQSNVAFWTGKWYSMGWHSMSQPAREFLCKITELSMFAADFILGHWLLFLMLPVIIV
PHVDKLHSMMLFWLRPSRQIRPPIYSMKQSKLRRRRVIRYAILYFVMLAVFIGLIAGPIVAGKQLSQDVLRSLGK
STSIGGFQLMQPNGQNNDNTNGTEETGTGKPGYSGAFTKSTTRTGAAEATSSGDGGKKIKLF*
Coding >OphauB2|4679
ATGTCTGGCTATCCTGGAGGTCATCACGACCAATATGATGATGGCTACGCCCATCAAGGTGGCGCCACAGACTCG
TACTATCAGGATGATCAGTACTATGACAATAGCTACGACGCTCGCGGCGGCCACAATGGCCAGGCTGCCCACGCT
GGCGATGGCTATTACGATGAGTCAGGCTATTACAACGCTGATCCCAACAATCCATACCATCAAGACGGCGGTTAC
TACGACGGCCATGACCAGTACCAGGATGAATACTACAATGGACAGAGCGGCTACTACGACCAAGATTATAGCAAC
GCGTATGCTGGTCACACTGGCCGCCACGGCTCCGAAGAGGACTCTGAAACTTTCAGTGATTTTACTATGAGGTCC
GACATGGCACGTGCTGCTGAAATGGATTACTATGGTCGCGGCGACGAGCGTCATAATAGCTACGGCGATGGCCAG
CGTGGCTACCGTCCCCCTTCGTCGCAGATATCTTATGGTGCAAACCGCTCTTCTGGTGCTTCAACGCCTAATTAT
GGCATGGATTACGGCAACGTTCTGCCAGCTGGCCAGCGTTCACGAGAACCATACCCTGCTTGGACTTCAGATGCC
CAGATTCCATTGTCCAAGGAGGAAATTGAAGACATTTTTTTGGACTTGACCGCAAAGTTTGGATTCCAGCGCGAC
AGTATGCGAAACATGTACGACCATCTCATGACTCTCCTTGACTCGAGGGCTTCGCGCATGACACCAAACCAAGCC
TTGCTCTCATTGCATGCTGATTACATCGGTGGCGAGAATGCTAATTATCGCAAGTGGTACTTTGCGGCTCACCTC
GATCTTGATGATGCGGTCGGCTTCGCCAATGCCAAGAGTAAGGGTTTGCGCCGCAAGGCCAAGAACAAGAAGAAA
AAGGGCGACGCCGCCAATGAGGCCGAAGCATTACAAGACCTTGAAGGTGATGATAGTCTGGAGGCTGCCGAGTAT
CGCTGGAAAACGCGCATGAACCGCATGTCGCAGCACGATCGCGTCCGTCAAATTGCTTTGTACCTCCTCTGCTGG
GGCGAAGCAAACCAGGTCCGCTTCATGCCAGAATGTCTGTGCTTCATATTCAAATGCGCCGACGATTATCTCAAT
TCGCCTGCCTGTCAGGCTTTGGTGGAACCCGTTGATGAGTTCACGTATCTCAACAACGTCATTACACCGCTTTAC
CAGTATGTCCGAGACCAAGGCTACGAGATTTTGAATGGCGTCTACGTTCGACGTGAGCGTGACCATAAACACATA
ATCGGTTACGATGATTGCAATCAGCTCTTTTGGTATCCCGAGGGCATCGAGCGCGTTGTGTTGCAGGACAAGAGC
AAGTTGGTGGACGTTCCTCCTGCCGAGCGTTACCTGAAACTCAAGGACGTGAACTGGAAGAAATGTTTCTTCAAA
ACTTACAAGGAAACTCGCTCGTGGTTCCACCTTCTAGTCAATTTCAACCGTATTTGGATCATTCATTTGACCATG
TTCTGGTTTTATACGTCGCACAATGCTCCGACACTGCTGGTCGGCTCCAAATACGAGCAGCAGGTCAATAATCAG
CCCCCCGGGTCCAAACAATTTTCAGTTGTGGCATTTGGCGGAGCTCTTGCAGCACTTATTCAGATTTTGGCTACC
CTCGCTGAATGGGCCTATGTCCCCCGCCGGTGGGCTGGTGCACAACATTTGACGAAGCGACTTCTATTCCTTATT
GTCATCTTCATCATCAACGTTGGTCCAGGAGTAAAAGTCTTTATGATTCCTACAGACAAGAAGAAAACTGGCGTC
GACATTGATCTCATCATTGGCATCGTGCATTTTGTCATCGCCATTATTACTTTTCTCTTTTTTGCTGTCATGCCT
CTCGGAGGCCTATTTGGCAGCTATCTGACCAAGAACTCGCGACGATACGTGGCCAGCCAGACATTTACCGCCAGC
TACCCCAGACTTTCTGGCAACGACATGGCGATGTCGTATGGACTTTGGTTGACTGTCTTTGGTGCCAAATTCGGA
GAATCATATGTCTACCTCACACTCTCGTTTCGAGATGTGATTCGTTATCTTTCCATTTTCCACCCGAGATGTCTT
GGCGACAAGATCATCGGCAAAATCCTTTGCGAAAATCATCCCTACATACTGCTAGGGTTGATGTTCTTCACGGAT
CTCATCTTCTTCTTTCTCGATACATACCTCTTTTACGTCTTGCTCGCCACTATTTTCTCTATTGCGCGCTCGTTC
TATATTGGATCTTCAATATGGACACCCTGGAGGAACATCTTCTCCCGTCTCCCTAAACGCATCTACTCCAAGATT
CTTGCTACGACGGATATGGAGATCAAGTATAAGCCCAAGGTGCTCATTTCTCAAGTCTGGAACGCCATCGTCATC
TCGATGTACCGGGAGCATTTGCTAGCTATCGATCATGTCCAGAAACTGCTTTATCATCAAGTTCCCTCGGAGCAA
GAAGGCAAGAGGACGTTACGAGCACCCACCTTTTTTGTGTCCCAGGAAGATCATTCGTTCAAGACAGAGTTCTTC
CCCAGCCATAGCGAGGCGGAGCGCCGGATTTCTTTCTTCGCACAGTCTCTGTCCACGCCAATTCCCGAACCTCTT
CCGGTCGACAATATGCCGACTTTCACTGTCATGATTCCTCATTACAGTGAGAAGATACTGTTGTCTCTGCGCGAA
ATCATTCGCGAAGATGAGCCTTATTCGCGTGTCACTCTTCTGGAGTACTTGAAGCAGCTGCATCCTCACGAGTGG
GATTGTTTTGTTAAAGATACCAAGATCTTGGCCGATGAGACATCACAAATGAACGGCGACTTGGAGAAGAATGAA
AAGGATGCTGCCAAGAGCAAGATTGATGACCTTCCATTCTACTGCATCGGTTTCAAGTCTTCGGCACCGGAGTAT
ACTCTGCGGACCCGGATCTGGGCCTCGCTGCGCTCACAGACACTGTACCGAACCGTGTCTGGATTTATGAACTAC
AGCCGTGCCATCAAGCTACTTTATCGTGTCGAGAATCCAGAAGTGGTCCAAATGTTTGGTGGAAACTCAGACAAG
CTGGAGCGTGAGTTGGAGCGCATGGCACGACGTAAATTCAAAATTGTTGTCTCAATGCAACGCTACTCGAAATTC
AAGAAAGAGGAAATGGAGAACGCAGAATTTTTGCTCCGCGCTTATCCTGATCTCCAAATCGCCTATCTTGATGAG
GAACCGCCAGTTGCCGAGGGTGAGGAGCCTCGACTTTACTCTGCGTTGATAGACGGGCACTCTGAACTCATGGAA
AACGGTATGCGGCGACCCAAATTTCGAATTCAGCTGTCGGGAAACCCTGTTTTAGGCGACGGTAAATCGGACAAT
CAGAATCATTCATTGATATTCTATCGTGGCGAATACATTCAGCTCATTGACGCGAATCAAGATAACTACCTCGAG
GAGTGTCTCAAGATCCGCAGCGTTCTAGCTGAATTTGAAGAAATGAAGATGGAAAATATCTCACCGTATACTCCA
GGTATCAAGAACGAAACATCAGCGCCCGTGGCAATTCTTGGAGCTCGCGAATACATCTTTTCCGAAAACATCGGC
ATCCTTGGTGACGTTGCTGCCGGAAAGGAACAGACTTTTGGTACGCTCTTTGCTCGTACGTTGGCACAGATTGGT
GGCAAACTGCATTACGGACATCCCGATTTTCTCAATGGCATCTTCATGACGACCCGCGGCGGTGTTTCCAAGGCC
CAGAAAGGACTGCATCTCAACGAAGATATCTTTGCCGGCATGAATGCTATACTTCGTGGTGGACGCATCAAGCAC
TGCGAGTATTACCAATGCGGCAAGGGTCGTGACCTTGGCTTTGGCTCAATCCTCAACTTTACGACCAAAATTGGA
ACAGGAATGGGAGAGCAAATGCTTTCTCGCGAATATTATTATCTCGGCACGCAGCTGCCTCTAGATCGGTTCCTG
TCCTTCTACTACGCACACCCAGGGTTCCACATTAACAACATGTTCATCCTGCTATCAGTCCAACTCTTCATGTTG
ACGCTTCTCAACTTTGGGGCTTTCAAGCACGAGACTGTTCGTTGTGACTATAACAGAAATAAGCCATTGACGGAC
CCGCTTTTCCCGACAGGATGTGCCAACACAGACGCAGTCATGGACTGGGTGCAACGCAGCATATTTTCCATTTTT
TTCGTCTTCTTTCTGTCATTTGTACCACTAATTGTTCAAGAACTGACGGAACGCGGTGTGTGGCGCGCACTAGTG
CGTTTTCTCAAGCAGTTTTTTTCACTTTCGCCATTCTTCGAAGTATTTGTCTGCCAGATCTACGCGAATTCTGTG
CAGCAAGATCTTTCGTTTGGCGGCGCTCGGTATATTGGCACGGGTCGCGGCTTTGCCACTGCTCGCATCCCATTT
GGTGTCTTGTACTCCCGCTTTGCCGGCCCATCTATCTATTTTGGCGCGCGGTTGCTCATGATGCTCCTGTTTGCC
ACGGTGACAGCTTGGCAGGCGGCGCTGGTATACTTCTGGATCACCTTGTTGGGCCTTACAATTTCGCCATTCCTG
TACAACCCACATCAATTTGCATGGAACGACTTCTTTATCGACTATCGTGACTTTCTCCGCTGGTTGTCCAGGGGC
AACTCGAGAAGTCATGCCTCGTCGTGGATTGCTTTCTGCCGCCTATCCCGGACGCGAATCACTGGATATAAGCGC
AAGACCTTGGGCGAAGCATCTGCCAAAATGTCCGCTGATGTTCCTCGAGCTGCTATTGCCAATATTTTCTTTACC
GAGATTTTGACACCTTTGCTCCAAGTTGTTTGGACGCTGATCCCATACCTCTTCATCAATGCTCAAACTGGCGTG
CTGCCATCAAACAACCGTGGCGCCAAGGTTCAGCCCACAGATTCTCTCATCCGAGTACTCCTCGTGTCTCTGGCT
CCAATTGGCATCAATGCTGGTGTCTTGGGCGTCATGTTCTTCATGGCTTGTTTCATGGGGCCAGTCTTGAGCATG
TGCTGTAAAAAGTTTGGCAGTGTACTAGCTGCTGTTGCTCACGGGGCTGCTGTCGTCTTTATGCTCATCTTCTTT
GAGGCCATGTTTGTGCTCGAGGGATTTAACTTTGCACGAACTATGGCGGGCATGATTGCAGTGGTCGCCATTCAA
AGGTTCATTTTCAAGCTTATTGTTTCTCTTGCGTTGACAAGAGAAATGAAGACTGATCAGTCCAATGTGGCCTTT
TGGACGGGCAAATGGTATTCCATGGGCTGGCACTCAATGTCTCAACCAGCGCGCGAATTTCTATGCAAGATTACG
GAACTCAGCATGTTCGCCGCCGATTTTATCCTCGGACATTGGCTTCTATTCTTGATGCTGCCAGTCATCATTGTA
CCACATGTGGACAAGCTACACTCGATGATGCTTTTTTGGCTTCGTCCAAGCCGCCAGATTCGACCCCCGATCTAT
TCTATGAAACAGTCAAAGCTGCGGCGCAGACGAGTCATTCGATATGCTATACTCTACTTCGTCATGCTGGCTGTG
TTTATTGGACTGATTGCTGGACCTATTGTGGCTGGCAAGCAGTTGAGCCAAGATGTTTTGCGGTCACTTGGAAAA
TCAACGTCGATTGGGGGCTTCCAGCTAATGCAGCCAAACGGGCAGAATAATGACAATACTAACGGCACAGAGGAG
ACTGGCACTGGAAAGCCTGGCTATAGCGGAGCATTTACAAAATCAACAACGAGGACAGGTGCCGCCGAGGCGACT
AGCTCTGGAGATGGTGGCAAGAAGATCAAGCTATTTTAA
Transcript >OphauB2|4679
ATGTCTGGCTATCCTGGAGGTCATCACGACCAATATGATGATGGCTACGCCCATCAAGGTGGCGCCACAGACTCG
TACTATCAGGATGATCAGTACTATGACAATAGCTACGACGCTCGCGGCGGCCACAATGGCCAGGCTGCCCACGCT
GGCGATGGCTATTACGATGAGTCAGGCTATTACAACGCTGATCCCAACAATCCATACCATCAAGACGGCGGTTAC
TACGACGGCCATGACCAGTACCAGGATGAATACTACAATGGACAGAGCGGCTACTACGACCAAGATTATAGCAAC
GCGTATGCTGGTCACACTGGCCGCCACGGCTCCGAAGAGGACTCTGAAACTTTCAGTGATTTTACTATGAGGTCC
GACATGGCACGTGCTGCTGAAATGGATTACTATGGTCGCGGCGACGAGCGTCATAATAGCTACGGCGATGGCCAG
CGTGGCTACCGTCCCCCTTCGTCGCAGATATCTTATGGTGCAAACCGCTCTTCTGGTGCTTCAACGCCTAATTAT
GGCATGGATTACGGCAACGTTCTGCCAGCTGGCCAGCGTTCACGAGAACCATACCCTGCTTGGACTTCAGATGCC
CAGATTCCATTGTCCAAGGAGGAAATTGAAGACATTTTTTTGGACTTGACCGCAAAGTTTGGATTCCAGCGCGAC
AGTATGCGAAACATGTACGACCATCTCATGACTCTCCTTGACTCGAGGGCTTCGCGCATGACACCAAACCAAGCC
TTGCTCTCATTGCATGCTGATTACATCGGTGGCGAGAATGCTAATTATCGCAAGTGGTACTTTGCGGCTCACCTC
GATCTTGATGATGCGGTCGGCTTCGCCAATGCCAAGAGTAAGGGTTTGCGCCGCAAGGCCAAGAACAAGAAGAAA
AAGGGCGACGCCGCCAATGAGGCCGAAGCATTACAAGACCTTGAAGGTGATGATAGTCTGGAGGCTGCCGAGTAT
CGCTGGAAAACGCGCATGAACCGCATGTCGCAGCACGATCGCGTCCGTCAAATTGCTTTGTACCTCCTCTGCTGG
GGCGAAGCAAACCAGGTCCGCTTCATGCCAGAATGTCTGTGCTTCATATTCAAATGCGCCGACGATTATCTCAAT
TCGCCTGCCTGTCAGGCTTTGGTGGAACCCGTTGATGAGTTCACGTATCTCAACAACGTCATTACACCGCTTTAC
CAGTATGTCCGAGACCAAGGCTACGAGATTTTGAATGGCGTCTACGTTCGACGTGAGCGTGACCATAAACACATA
ATCGGTTACGATGATTGCAATCAGCTCTTTTGGTATCCCGAGGGCATCGAGCGCGTTGTGTTGCAGGACAAGAGC
AAGTTGGTGGACGTTCCTCCTGCCGAGCGTTACCTGAAACTCAAGGACGTGAACTGGAAGAAATGTTTCTTCAAA
ACTTACAAGGAAACTCGCTCGTGGTTCCACCTTCTAGTCAATTTCAACCGTATTTGGATCATTCATTTGACCATG
TTCTGGTTTTATACGTCGCACAATGCTCCGACACTGCTGGTCGGCTCCAAATACGAGCAGCAGGTCAATAATCAG
CCCCCCGGGTCCAAACAATTTTCAGTTGTGGCATTTGGCGGAGCTCTTGCAGCACTTATTCAGATTTTGGCTACC
CTCGCTGAATGGGCCTATGTCCCCCGCCGGTGGGCTGGTGCACAACATTTGACGAAGCGACTTCTATTCCTTATT
GTCATCTTCATCATCAACGTTGGTCCAGGAGTAAAAGTCTTTATGATTCCTACAGACAAGAAGAAAACTGGCGTC
GACATTGATCTCATCATTGGCATCGTGCATTTTGTCATCGCCATTATTACTTTTCTCTTTTTTGCTGTCATGCCT
CTCGGAGGCCTATTTGGCAGCTATCTGACCAAGAACTCGCGACGATACGTGGCCAGCCAGACATTTACCGCCAGC
TACCCCAGACTTTCTGGCAACGACATGGCGATGTCGTATGGACTTTGGTTGACTGTCTTTGGTGCCAAATTCGGA
GAATCATATGTCTACCTCACACTCTCGTTTCGAGATGTGATTCGTTATCTTTCCATTTTCCACCCGAGATGTCTT
GGCGACAAGATCATCGGCAAAATCCTTTGCGAAAATCATCCCTACATACTGCTAGGGTTGATGTTCTTCACGGAT
CTCATCTTCTTCTTTCTCGATACATACCTCTTTTACGTCTTGCTCGCCACTATTTTCTCTATTGCGCGCTCGTTC
TATATTGGATCTTCAATATGGACACCCTGGAGGAACATCTTCTCCCGTCTCCCTAAACGCATCTACTCCAAGATT
CTTGCTACGACGGATATGGAGATCAAGTATAAGCCCAAGGTGCTCATTTCTCAAGTCTGGAACGCCATCGTCATC
TCGATGTACCGGGAGCATTTGCTAGCTATCGATCATGTCCAGAAACTGCTTTATCATCAAGTTCCCTCGGAGCAA
GAAGGCAAGAGGACGTTACGAGCACCCACCTTTTTTGTGTCCCAGGAAGATCATTCGTTCAAGACAGAGTTCTTC
CCCAGCCATAGCGAGGCGGAGCGCCGGATTTCTTTCTTCGCACAGTCTCTGTCCACGCCAATTCCCGAACCTCTT
CCGGTCGACAATATGCCGACTTTCACTGTCATGATTCCTCATTACAGTGAGAAGATACTGTTGTCTCTGCGCGAA
ATCATTCGCGAAGATGAGCCTTATTCGCGTGTCACTCTTCTGGAGTACTTGAAGCAGCTGCATCCTCACGAGTGG
GATTGTTTTGTTAAAGATACCAAGATCTTGGCCGATGAGACATCACAAATGAACGGCGACTTGGAGAAGAATGAA
AAGGATGCTGCCAAGAGCAAGATTGATGACCTTCCATTCTACTGCATCGGTTTCAAGTCTTCGGCACCGGAGTAT
ACTCTGCGGACCCGGATCTGGGCCTCGCTGCGCTCACAGACACTGTACCGAACCGTGTCTGGATTTATGAACTAC
AGCCGTGCCATCAAGCTACTTTATCGTGTCGAGAATCCAGAAGTGGTCCAAATGTTTGGTGGAAACTCAGACAAG
CTGGAGCGTGAGTTGGAGCGCATGGCACGACGTAAATTCAAAATTGTTGTCTCAATGCAACGCTACTCGAAATTC
AAGAAAGAGGAAATGGAGAACGCAGAATTTTTGCTCCGCGCTTATCCTGATCTCCAAATCGCCTATCTTGATGAG
GAACCGCCAGTTGCCGAGGGTGAGGAGCCTCGACTTTACTCTGCGTTGATAGACGGGCACTCTGAACTCATGGAA
AACGGTATGCGGCGACCCAAATTTCGAATTCAGCTGTCGGGAAACCCTGTTTTAGGCGACGGTAAATCGGACAAT
CAGAATCATTCATTGATATTCTATCGTGGCGAATACATTCAGCTCATTGACGCGAATCAAGATAACTACCTCGAG
GAGTGTCTCAAGATCCGCAGCGTTCTAGCTGAATTTGAAGAAATGAAGATGGAAAATATCTCACCGTATACTCCA
GGTATCAAGAACGAAACATCAGCGCCCGTGGCAATTCTTGGAGCTCGCGAATACATCTTTTCCGAAAACATCGGC
ATCCTTGGTGACGTTGCTGCCGGAAAGGAACAGACTTTTGGTACGCTCTTTGCTCGTACGTTGGCACAGATTGGT
GGCAAACTGCATTACGGACATCCCGATTTTCTCAATGGCATCTTCATGACGACCCGCGGCGGTGTTTCCAAGGCC
CAGAAAGGACTGCATCTCAACGAAGATATCTTTGCCGGCATGAATGCTATACTTCGTGGTGGACGCATCAAGCAC
TGCGAGTATTACCAATGCGGCAAGGGTCGTGACCTTGGCTTTGGCTCAATCCTCAACTTTACGACCAAAATTGGA
ACAGGAATGGGAGAGCAAATGCTTTCTCGCGAATATTATTATCTCGGCACGCAGCTGCCTCTAGATCGGTTCCTG
TCCTTCTACTACGCACACCCAGGGTTCCACATTAACAACATGTTCATCCTGCTATCAGTCCAACTCTTCATGTTG
ACGCTTCTCAACTTTGGGGCTTTCAAGCACGAGACTGTTCGTTGTGACTATAACAGAAATAAGCCATTGACGGAC
CCGCTTTTCCCGACAGGATGTGCCAACACAGACGCAGTCATGGACTGGGTGCAACGCAGCATATTTTCCATTTTT
TTCGTCTTCTTTCTGTCATTTGTACCACTAATTGTTCAAGAACTGACGGAACGCGGTGTGTGGCGCGCACTAGTG
CGTTTTCTCAAGCAGTTTTTTTCACTTTCGCCATTCTTCGAAGTATTTGTCTGCCAGATCTACGCGAATTCTGTG
CAGCAAGATCTTTCGTTTGGCGGCGCTCGGTATATTGGCACGGGTCGCGGCTTTGCCACTGCTCGCATCCCATTT
GGTGTCTTGTACTCCCGCTTTGCCGGCCCATCTATCTATTTTGGCGCGCGGTTGCTCATGATGCTCCTGTTTGCC
ACGGTGACAGCTTGGCAGGCGGCGCTGGTATACTTCTGGATCACCTTGTTGGGCCTTACAATTTCGCCATTCCTG
TACAACCCACATCAATTTGCATGGAACGACTTCTTTATCGACTATCGTGACTTTCTCCGCTGGTTGTCCAGGGGC
AACTCGAGAAGTCATGCCTCGTCGTGGATTGCTTTCTGCCGCCTATCCCGGACGCGAATCACTGGATATAAGCGC
AAGACCTTGGGCGAAGCATCTGCCAAAATGTCCGCTGATGTTCCTCGAGCTGCTATTGCCAATATTTTCTTTACC
GAGATTTTGACACCTTTGCTCCAAGTTGTTTGGACGCTGATCCCATACCTCTTCATCAATGCTCAAACTGGCGTG
CTGCCATCAAACAACCGTGGCGCCAAGGTTCAGCCCACAGATTCTCTCATCCGAGTACTCCTCGTGTCTCTGGCT
CCAATTGGCATCAATGCTGGTGTCTTGGGCGTCATGTTCTTCATGGCTTGTTTCATGGGGCCAGTCTTGAGCATG
TGCTGTAAAAAGTTTGGCAGTGTACTAGCTGCTGTTGCTCACGGGGCTGCTGTCGTCTTTATGCTCATCTTCTTT
GAGGCCATGTTTGTGCTCGAGGGATTTAACTTTGCACGAACTATGGCGGGCATGATTGCAGTGGTCGCCATTCAA
AGGTTCATTTTCAAGCTTATTGTTTCTCTTGCGTTGACAAGAGAAATGAAGACTGATCAGTCCAATGTGGCCTTT
TGGACGGGCAAATGGTATTCCATGGGCTGGCACTCAATGTCTCAACCAGCGCGCGAATTTCTATGCAAGATTACG
GAACTCAGCATGTTCGCCGCCGATTTTATCCTCGGACATTGGCTTCTATTCTTGATGCTGCCAGTCATCATTGTA
CCACATGTGGACAAGCTACACTCGATGATGCTTTTTTGGCTTCGTCCAAGCCGCCAGATTCGACCCCCGATCTAT
TCTATGAAACAGTCAAAGCTGCGGCGCAGACGAGTCATTCGATATGCTATACTCTACTTCGTCATGCTGGCTGTG
TTTATTGGACTGATTGCTGGACCTATTGTGGCTGGCAAGCAGTTGAGCCAAGATGTTTTGCGGTCACTTGGAAAA
TCAACGTCGATTGGGGGCTTCCAGCTAATGCAGCCAAACGGGCAGAATAATGACAATACTAACGGCACAGAGGAG
ACTGGCACTGGAAAGCCTGGCTATAGCGGAGCATTTACAAAATCAACAACGAGGACAGGTGCCGCCGAGGCGACT
AGCTCTGGAGATGGTGGCAAGAAGATCAAGCTATTTTAA
Gene >OphauB2|4679
ATGTCTGGCTATCCTGGAGGTCATCACGACCAATATGATGATGGCTACGCCCATCAAGGTGGCGCCACAGACTCG
TACTATCAGGATGATCAGTACTATGACAATAGCTACGACGCTCGCGGCGGCCACAATGGCCAGGCTGCCCACGCT
GGCGATGGCTATTACGATGAGTCGTCAGTTGTTAACACTCTTGTTACTCTTCTGTCGAGTTTTCTGCTAATACAC
TGCTTAGAGGCTATTACAACGCTGATCCCAACAATCCATACCATCAAGACGGCGGTTACTACGACGGCCATGACC
AGTACCAGGATGAATACTACAATGGACAGAGCGGCTACTACGACCAAGATTATAGCAACGCGTATGCTGGTCACA
CTGGCCGCCACGGCTCCGAAGAGGACTCTGAAACTTTCAGTGATTTTACTATGAGGTCCGACATGGCACGTGCTG
CTGAAATGGATTACTATGGTCGCGGCGACGAGCGTCATAATAGCTACGGCGATGGCCAGCGTGGCTACCGTCCCC
CTTCGTCGCAGATATCTTATGGTGCAAACCGCTCTTCTGGTGCTTCAACGCCTAATTATGGCATGGATTACGGCA
ACGTTCTGCCAGCTGGCCAGCGTTCACGAGAACCATACCCTGCTTGGACTTCAGATGCCCAGATTCCATTGTCCA
AGGAGGAAATTGAAGACATTTTTTTGGACTTGACCGCAAAGTTTGGATTCCAGCGCGACAGTATGCGAAACATGT
ACGACCATCTCATGACTCTCCTTGACTCGAGGGCTTCGCGCATGACACCAAACCAAGCCTTGCTCTCATTGCATG
CTGATTACATCGGTGGCGAGAATGCTAATTATCGCAAGTGGTACTTTGCGGCTCACCTCGATCTTGATGATGCGG
TCGGCTTCGCCAATGCCAAGAGTAAGGGTTTGCGCCGCAAGGCCAAGAACAAGAAGAAAAAGGGCGACGCCGCCA
ATGAGGCCGAAGCATTACAAGACCTTGAAGGTGATGATAGTCTGGAGGCTGCCGAGTATCGCTGGAAAACGCGCA
TGAACCGCATGTCGCAGCACGATCGCGTCCGTCAAATTGCTTTGTACCTCCTCTGCTGGGGCGAAGCAAACCAGG
TCCGCTTCATGCCAGAATGTCTGTGCTTCATATTCAAATGCGCCGACGATTATCTCAATTCGCCTGCCTGTCAGG
CTTTGGTGGAACCCGTTGATGAGTTCACGTATCTCAACAACGTCATTACACCGCTTTACCAGTATGTCCGAGACC
AAGGCTACGAGATTTTGAATGGCGTCTACGTTCGACGTGAGCGTGACCATAAACACATAATCGGTTACGATGATT
GCAATCAGCTCTTTTGGTATCCCGAGGGCATCGAGCGCGTTGTGTTGCAGGACAAGAGCAAGTTGGTGGACGTTC
CTCCTGCCGAGCGTTACCTGAAACTCAAGGACGTGAACTGGAAGAAATGTTTCTTCAAAACTTACAAGGAAACTC
GCTCGTGGTTCCACCTTCTAGTCAATTTCAACCGTATTTGGATCATTCATTTGACCATGTTCTGGTTTTATACGT
CGCACAATGCTCCGACACTGCTGGTCGGCTCCAAATACGAGCAGCAGGTCAATAATCAGCCCCCCGGGTCCAAAC
AATTTTCAGTTGTGGCATTTGGCGGAGCTCTTGCAGCACTTATTCAGATTTTGGCTACCCTCGCTGAATGGGCCT
ATGTCCCCCGCCGGTGGGCTGGTGCACAACATTTGACGAAGCGACTTCTATTCCTTATTGTCATCTTCATCATCA
ACGTTGGTCCAGGAGTAAAAGTCTTTATGATTCCTACAGACAAGAAGAAAACTGGCGTCGACATTGATCTCATCA
TTGGCATCGTGCATTTTGTCATCGCCATTATTACTTTTCTCTTTTTTGCTGTCATGCCTCTCGGAGGCCTATTTG
GCAGCTATCTGACCAAGAACTCGCGACGATACGTGGCCAGCCAGACATTTACCGCCAGCTACCCCAGACTTTCTG
GCAACGACATGGCGATGTCGTATGGACTTTGGTTGACTGTCTTTGGTGCCAAATTCGGAGAATCATATGTCTACC
TCACACTCTCGTTTCGAGATGTGATTCGTTATCTTTCCATTTTCCACCCGAGATGTCTTGGCGACAAGATCATCG
GCAAAATCCTTTGCGAAAATCATCCCTACATACTGCTAGGGTTGATGTTCTTCACGGATCTCATCTTCTTCTTTC
TCGATACATACCTCTTTTACGTCTTGCTCGCCACTATTTTCTCTATTGCGCGCTCGTTCTATATTGGATCTTCAA
TATGGACACCCTGGAGGAACATCTTCTCCCGTCTCCCTAAACGCATCTACTCCAAGATTCTTGCTACGACGGATA
TGGAGATCAAGTATAAGCCCAAGGTGCTCATTTCTCAAGTCTGGAACGCCATCGTCATCTCGATGTACCGGGAGC
ATTTGCTAGCTATCGATCATGTCCAGAAACTGCTTTATCATCAAGTTCCCTCGGAGCAAGAAGGCAAGAGGACGT
TACGAGCACCCACCTTTTTTGTGTCCCAGGAAGATCATTCGTTCAAGACAGAGTTCTTCCCCAGCCATAGCGAGG
CGGAGCGCCGGATTTCTTTCTTCGCACAGTCTCTGTCCACGCCAATTCCCGAACCTCTTCCGGTCGACAATATGC
CGACTTTCACTGTCATGATTCCTCATTACAGTGAGAAGATACTGTTGTCTCTGCGCGAAATCATTCGCGAAGATG
AGCCTTATTCGCGTGTCACTCTTCTGGAGTACTTGAAGCAGCTGCATCCTCACGAGTGGGATTGTTTTGTTAAAG
ATACCAAGATCTTGGCCGATGAGACATCACAAATGAACGGCGACTTGGAGAAGAATGAAAAGGATGCTGCCAAGA
GCAAGATTGATGACCTTCCATTCTACTGCATCGGTTTCAAGTCTTCGGCACCGGAGTATACTCTGCGGACCCGGA
TCTGGGCCTCGCTGCGCTCACAGACACTGTACCGAACCGTGTCTGGATTTATGAACTACAGCCGTGCCATCAAGC
TACTTTATCGTGTCGAGAATCCAGAAGTGGTCCAAATGTTTGGTGGAAACTCAGACAAGCTGGAGCGTGAGTTGG
AGCGCATGGCACGACGTAAATTCAAAATTGTTGTCTCAATGCAACGCTACTCGAAATTCAAGAAAGAGGAAATGG
AGAACGCAGAATTTTTGCTCCGCGCTTATCCTGATCTCCAAATCGCCTATCTTGATGAGGAACCGCCAGTTGCCG
AGGGTGAGGAGCCTCGACTTTACTCTGCGTTGATAGACGGGCACTCTGAACTCATGGAAAACGGTATGCGGCGAC
CCAAATTTCGAATTCAGCTGTCGGGAAACCCTGTTTTAGGCGACGGTAAATCGGACAATCAGAATCATTCATTGA
TATTCTATCGTGGCGAATACATTCAGCTCATTGACGCGAATCAAGATAACTACCTCGAGGAGTGTCTCAAGATCC
GCAGCGTTCTAGCTGAATTTGAAGAAATGAAGATGGAAAATATCTCACCGTATACTCCAGGTATCAAGAACGAAA
CATCAGCGCCCGTGGCAATTCTTGGAGCTCGCGAATACATCTTTTCCGAAAACATCGGCATCCTTGGTGACGTTG
CTGCCGGAAAGGAACAGACTTTTGGTACGCTCTTTGCTCGTACGTTGGCACAGATTGGTGGCAAACTGCATTACG
GACATCCCGATTTTCTCAATGGCATCTTCATGACGACCCGCGGCGGTGTTTCCAAGGCCCAGAAAGGACTGCATC
TCAACGAAGATATCTTTGCCGGCATGAATGCTATACTTCGTGGTGGACGCATCAAGCACTGCGAGTATTACCAAT
GCGGCAAGGGTCGTGACCTTGGCTTTGGCTCAATCCTCAACTTTACGACCAAAATTGGAACAGGAATGGGAGAGC
AAATGCTTTCTCGCGAATATTATTATCTCGGCACGCAGCTGCCTCTAGATCGGTTCCTGTCCTTCTACTACGCAC
ACCCAGGGTTCCACATTAACAACATGTTCATCCTGCTATCAGTCCAACTCTTCATGTTGACGCTTCTCAACTTTG
GGGCTTTCAAGCACGAGACTGTTCGTTGTGACTATAACAGAAATAAGCCATTGACGGACCCGCTTTTCCCGACAG
GATGTGCCAACACAGACGCAGTCATGGACTGGGTGCAACGCAGCATATTTTCCATTTTTTTCGTCTTCTTTCTGT
CATTTGTACCACTAATTGTTCAAGAACTGACGGAACGCGGTGTGTGGCGCGCACTAGTGCGTTTTCTCAAGCAGT
TTTTTTCACTTTCGCCATTCTTCGAAGTATTTGTCTGCCAGATCTACGCGAATTCTGTGCAGCAAGATCTTTCGT
TTGGCGGCGCTCGGTATATTGGCACGGGTCGCGGCTTTGCCACTGCTCGCATCCCATTTGGTGTCTTGTACTCCC
GCTTTGCCGGCCCATCTATCTATTTTGGCGCGCGGTTGCTCATGATGCTCCTGTTTGCCACGGTGACAGCTTGGC
AGGCGGCGCTGGTATACTTCTGGATCACCTTGTTGGGCCTTACAATTTCGCCATTCCTGTACAACCCACATCAAT
TTGCATGGAACGACTTCTTTATCGACTATCGTGACTTTCTCCGCTGGTTGTCCAGGGGCAACTCGAGAAGTCATG
CCTCGTCGTGGATTGCTTTCTGCCGCCTATCCCGGACGCGAATCACTGGATATAAGCGCAAGACCTTGGGCGAAG
CATCTGCCAAAATGTCCGCTGATGTTCCTCGAGCTGCTATTGCCAATATTTTCTTTACCGAGATTTTGACACCTT
TGCTCCAAGTTGTTTGGACGCTGATCCCATACCTCTTCATCAATGCTCAAACTGGCGTGCTGCCATCAAACAACC
GTGGCGCCAAGGTTCAGCCCACAGATTCTCTCATCCGAGTACTCCTCGTGTCTCTGGCTCCAATTGGCATCAATG
CTGGTGTCTTGGGCGTCATGTTCTTCATGGCTTGTTTCATGGGGCCAGTCTTGAGCATGTGCTGTAAAAAGTTTG
GCAGTGTACTAGCTGCTGTTGCTCACGGGGCTGCTGTCGTCTTTATGCTCATCTTCTTTGAGGCCATGTTTGTGC
TCGAGGGATTTAACTTTGCACGAACTATGGCGGGCATGATTGCAGTGGTCGCCATTCAAAGGTTCATTTTCAAGC
TTATTGTTTCTCTTGCGTTGACAAGAGAAATGAAGACTGATCAGTCCAATGTGGCCTTTTGGACGGGCAAATGGT
ATTCCATGGGCTGGCACTCAATGTCTCAACCAGCGCGCGAATTTCTATGCAAGATTACGGAACTCAGCATGTTCG
CCGCCGATTTTATCCTCGGACATTGGCTTCTATTCTTGATGCTGCCAGTCATCATTGTACCACATGTGGACAAGC
TACACTCGATGATGCTTTTTTGGCTTCGTCCAAGGTATGTCGTTGAACAGTCGTTTGTGTTTTCCTCTAGTTATT
CTAAAACGCGGAGCTAATATCAATTGTCCTCAGCCGCCAGATTCGACCCCCGATCTATTCTATGAAACAGTCAAA
GCTGCGGCGCAGACGAGTCATTCGATATGCTATACTCTACTTCGTCATGCTGGCTGTGTTTATTGGACTGATTGC
TGGACCTATTGTGGCTGGCAAGCAGTTGAGCCAAGATGTTTTGCGGTCACTTGGAAAATCAACGTCGATTGGGGG
CTTCCAGCTAATGCAGCCAAACGGGCAGAATAATGACAATACTAACGGCACAGAGGAGACTGGCACTGGAAAGCC
TGGCTATAGCGGAGCATTTACAAAATCAACAACGAGGACAGGTGCCGCCGAGGCGACTAGCTCTGGAGATGGTGG
CAAGAAGATCAAGCTATTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail