Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4674
Gene name
LocationContig_315:3370..7080
Strand-
Gene length (bp)3710
Transcript length (bp)3489
Coding sequence length (bp)3489
Protein length (aa) 1163

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02463 SMC_N RecF/RecN/SMC N terminal domain 1.4E-22 122 1134
PF13476 AAA_23 AAA domain 8.0E-15 124 375
PF13175 AAA_15 AAA ATPase domain 4.0E-13 122 376

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53692|SMC6_SCHPO Structural maintenance of chromosomes protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smc6 PE=1 SV=1 120 1156 2.0E-141
sp|Q96SB8|SMC6_HUMAN Structural maintenance of chromosomes protein 6 OS=Homo sapiens GN=SMC6 PE=1 SV=2 117 1156 2.0E-122
sp|Q6P9I7|SMC6_XENLA Structural maintenance of chromosomes protein 6 OS=Xenopus laevis GN=smc6 PE=2 SV=1 105 1156 4.0E-117
sp|Q924W5|SMC6_MOUSE Structural maintenance of chromosomes protein 6 OS=Mus musculus GN=Smc6 PE=1 SV=1 117 1156 2.0E-115
sp|Q12749|SMC6_YEAST Structural maintenance of chromosomes protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC6 PE=1 SV=1 74 1156 4.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53692|SMC6_SCHPO Structural maintenance of chromosomes protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smc6 PE=1 SV=1 120 1156 2.0E-141
sp|Q96SB8|SMC6_HUMAN Structural maintenance of chromosomes protein 6 OS=Homo sapiens GN=SMC6 PE=1 SV=2 117 1156 2.0E-122
sp|Q6P9I7|SMC6_XENLA Structural maintenance of chromosomes protein 6 OS=Xenopus laevis GN=smc6 PE=2 SV=1 105 1156 4.0E-117
sp|Q924W5|SMC6_MOUSE Structural maintenance of chromosomes protein 6 OS=Mus musculus GN=Smc6 PE=1 SV=1 117 1156 2.0E-115
sp|Q12749|SMC6_YEAST Structural maintenance of chromosomes protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC6 PE=1 SV=1 74 1156 4.0E-92
sp|Q802R8|SMC6_TAKRU Structural maintenance of chromosomes protein 6 OS=Takifugu rubripes GN=smc6 PE=2 SV=1 116 702 5.0E-66
sp|Q54I56|SMC6_DICDI Structural maintenance of chromosomes protein 6 OS=Dictyostelium discoideum GN=smc6 PE=3 SV=1 106 375 1.0E-52
sp|Q9FLR5|SMC6A_ARATH Structural maintenance of chromosomes protein 6A OS=Arabidopsis thaliana GN=SMC6A PE=2 SV=1 119 611 2.0E-50
sp|Q9FII7|SMC6B_ARATH Structural maintenance of chromosomes protein 6B OS=Arabidopsis thaliana GN=SMC6B PE=2 SV=1 119 678 7.0E-46
sp|Q9FII7|SMC6B_ARATH Structural maintenance of chromosomes protein 6B OS=Arabidopsis thaliana GN=SMC6B PE=2 SV=1 955 1157 1.0E-21
sp|O13710|SMC5_SCHPO Structural maintenance of chromosomes protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smc5 PE=1 SV=3 120 270 2.0E-11
sp|Q9LFS8|SMC5_ARATH Structural maintenance of chromosomes protein 5 OS=Arabidopsis thaliana GN=SMC5 PE=2 SV=1 120 270 5.0E-11
sp|Q802R9|SMC5_TAKRU Structural maintenance of chromosomes protein 5 OS=Takifugu rubripes GN=smc5 PE=2 SV=1 120 270 3.0E-10
sp|Q8IY18|SMC5_HUMAN Structural maintenance of chromosomes protein 5 OS=Homo sapiens GN=SMC5 PE=1 SV=2 120 270 1.0E-09
sp|Q8CG46|SMC5_MOUSE Structural maintenance of chromosomes protein 5 OS=Mus musculus GN=Smc5 PE=1 SV=1 108 270 5.0E-09
sp|Q08204|SMC5_YEAST Structural maintenance of chromosomes protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC5 PE=1 SV=1 118 270 5.0E-09
sp|Q805A1|SMC5_XENLA Structural maintenance of chromosomes protein 5 OS=Xenopus laevis GN=smc5 PE=2 SV=1 120 200 3.0E-08
sp|Q5ZJY5|SMC5_CHICK Structural maintenance of chromosomes protein 5 OS=Gallus gallus GN=SMC5 PE=2 SV=1 120 196 2.0E-07
sp|Q805A1|SMC5_XENLA Structural maintenance of chromosomes protein 5 OS=Xenopus laevis GN=smc5 PE=2 SV=1 987 1140 1.0E-06
sp|Q8CG46|SMC5_MOUSE Structural maintenance of chromosomes protein 5 OS=Mus musculus GN=Smc5 PE=1 SV=1 894 1140 4.0E-06
sp|A3PMS2|SMC_RHOS1 Chromosome partition protein Smc OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=smc PE=3 SV=2 908 1138 5.0E-06
sp|Q7UQV4|SMC_RHOBA Chromosome partition protein Smc OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=smc PE=3 SV=2 820 1110 6.0E-06
sp|Q97WH0|RAD50_SULSO DNA double-strand break repair Rad50 ATPase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rad50 PE=3 SV=1 122 198 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0140664 ATP-dependent DNA damage sensor activity Yes
GO:0003824 catalytic activity No
GO:0140612 DNA damage sensor activity No
GO:0140657 ATP-dependent activity No
GO:0140299 small molecule sensor activity No
GO:0003674 molecular_function No
GO:0140097 catalytic activity, acting on DNA No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0140640 catalytic activity, acting on a nucleic acid No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4674
MPIKRNRPAAIDGDEDDDASDALHSSAHAKKRARISFGEHTSDTGDSWHSQDDHDNGDHDDEDEEVFEDRDAHPL
TQYEIMRDAGFRHLKNTKIDDLRATQKLKQRSATVKRGSLIAESGIIESITCCNFMCHDRLHVQLGPLINFIVGE
NGSGKSAVLTALTLCLGGKASDTNRGGSLKSFVKEGRDHGSLSVRIKNSGADSYHHDVYGNTIAVERHFSRTGSS
GFKIKSETGRIISNKKQEVDEICEWYALQMGNPLTVLSQDNARQFLNSASDTQKYKYFVSGVQLEQLDHDYKMSQ
DTLDRTLTLRNDLNEKIGCIKKEMLDAERLAETVQKNQSIRDKARLYRNQLVWLQVAEQEQELERQTKDLNSHDE
MISRMELECENRGEALHGAEDKLQQARLHRESLDGEQGSFVEKIEAAENAHDAVNRELSELCLEERDAFSRLKIF
KSEIETCETRIQQEEERLNQSTGPERIEKETELSQIMSLEVKIGEQLSENKLHRPVLESGLAEAERALIQQQKLR
NTKSNDVETARRRVRDIERSTGSIYDGFDRDIASLVGAIQNDTGFENKPVGPLGVHVKLLKPEWSAILEKMFGDG
LNAFVVRNKRDQSRLSALMHRIGLQKSPPIYIAYGGHIDTKSQEPDEHFDTVLRILEFDEDLVRTQLIINSQIEK
IILVKERLEAERIMIDNGPPCNVAACICFHDGKGKRGQGLRITNRQGTISTSPMLPSVLKPRMQSEAGRQLSVQN
DNLQQARMDLADVEADLRRSNEAVVQCKEELEAHCKAVTVLETKLRRVRADIDRVQVELDEFEGVDGRLMTLRSE
LEKKRSEERQVGNQYGKMRLAKRHVTTKTDEAKEKLESHKLRLADFNSKVSKADKKIATLEAMRRIAVADKNAAH
ERLEMKKAERVRAEEKRDRQAQDVENFISQAQQVAPERVYVPDGEDYRSIENKYEKIGEQLAQRQARLGASDQEI
YDRANEARTRYEDVMKQTRDVDETAEALKRAIEHRLHLWRQFQRQISARVRIQFNYLLSERGFRGKIDLNHRARK
VIIHIEPDETRKSSAGRSTKTLSGGEKSFSSICMLLSIWEAIGSPIRCLDEFDVFMDNVNRAISTNMLIDTARRS
VSRQYILITPNAIEGRARLGDDVKVVRLTDPRQHTLV*
Coding >OphauB2|4674
ATGCCTATTAAACGAAACCGACCTGCTGCTATAGATGGCGACGAGGATGACGATGCCAGTGACGCGCTCCACTCG
TCTGCACATGCTAAAAAAAGAGCACGCATATCATTCGGTGAACATACATCAGATACGGGCGATTCTTGGCACTCC
CAGGACGACCATGACAATGGCGACCACGACGATGAGGATGAGGAAGTATTTGAGGACCGCGACGCTCATCCGCTG
ACACAGTACGAGATCATGCGAGATGCTGGCTTTCGTCATTTGAAGAACACGAAAATAGACGATTTGCGAGCGACA
CAAAAGCTTAAACAGCGGTCAGCCACCGTCAAACGAGGAAGTCTGATAGCAGAAAGCGGAATCATTGAAAGCATC
ACATGCTGTAACTTCATGTGTCATGATCGGCTCCACGTTCAGCTTGGTCCACTGATAAATTTCATTGTTGGAGAA
AACGGTAGCGGCAAAAGTGCTGTCTTGACAGCACTGACCCTTTGCTTGGGCGGCAAGGCTAGTGACACTAATCGG
GGGGGAAGCCTCAAGAGCTTTGTCAAGGAGGGACGGGACCATGGAAGTCTTAGTGTCAGAATCAAGAATTCCGGT
GCCGATTCCTATCACCATGACGTATATGGTAACACAATTGCCGTCGAGCGCCACTTTTCCAGAACGGGTAGCAGT
GGCTTCAAAATCAAATCAGAAACGGGTCGAATCATCTCGAATAAAAAGCAAGAAGTCGACGAAATATGTGAATGG
TATGCGCTGCAAATGGGCAATCCACTTACCGTCTTATCCCAGGATAACGCTCGCCAATTCCTCAACTCTGCAAGT
GACACACAAAAGTATAAGTACTTCGTTTCGGGTGTGCAGCTCGAACAACTTGATCACGACTACAAAATGTCTCAA
GACACGCTCGACAGGACCCTTACCTTGCGCAATGATCTCAATGAAAAGATAGGCTGTATCAAAAAGGAGATGCTC
GACGCTGAGAGATTGGCTGAGACTGTGCAAAAAAACCAGAGCATTCGAGACAAGGCCAGACTCTACCGTAACCAA
CTGGTATGGTTGCAGGTAGCAGAGCAAGAGCAAGAACTCGAGCGCCAAACCAAGGATTTGAACAGCCACGATGAA
ATGATTTCTCGAATGGAGCTCGAATGCGAGAACAGAGGAGAAGCCTTACATGGGGCAGAGGACAAGTTGCAACAA
GCCCGATTGCATCGAGAAAGCCTCGACGGGGAGCAAGGTTCCTTTGTCGAGAAAATAGAAGCAGCCGAAAATGCC
CATGATGCTGTTAACAGGGAGCTATCGGAGCTATGTCTCGAAGAACGGGATGCTTTTAGTCGTCTCAAGATATTC
AAATCAGAAATTGAGACCTGTGAGACAAGGATACAGCAAGAAGAAGAACGCTTGAACCAGTCTACCGGGCCTGAG
CGTATAGAAAAAGAGACAGAGCTATCACAGATAATGTCCTTGGAGGTAAAAATTGGCGAGCAACTCTCAGAGAAT
AAGTTGCACCGGCCTGTACTAGAATCTGGACTCGCCGAGGCAGAGCGGGCTCTTATTCAGCAACAAAAGCTCCGG
AATACCAAGTCCAACGACGTTGAGACAGCCAGAAGAAGAGTCAGAGATATTGAGCGAAGCACTGGCTCTATCTAT
GACGGCTTTGACCGAGACATAGCCAGCCTGGTAGGGGCGATACAGAATGACACAGGGTTCGAAAACAAGCCGGTT
GGACCCCTGGGCGTACATGTCAAGCTATTGAAGCCCGAATGGTCCGCGATTTTGGAAAAGATGTTTGGAGACGGA
TTAAACGCCTTTGTTGTCAGAAACAAACGCGATCAGTCCAGATTGTCGGCCTTGATGCATAGGATTGGACTGCAA
AAGTCGCCACCGATTTACATTGCCTATGGAGGACACATAGACACAAAGAGCCAAGAGCCTGATGAGCATTTTGAC
ACGGTTCTGCGCATTCTCGAGTTTGATGAGGATCTCGTTCGGACCCAACTCATCATCAATAGCCAGATAGAAAAG
ATCATTCTTGTCAAGGAACGTTTAGAAGCTGAGCGCATCATGATTGACAACGGACCACCTTGCAACGTGGCGGCT
TGTATCTGCTTTCACGATGGCAAAGGGAAACGTGGTCAAGGCTTGCGCATCACCAACCGGCAGGGGACTATCAGT
ACAAGCCCTATGCTGCCCAGCGTCTTGAAGCCCAGAATGCAATCCGAGGCGGGCAGACAACTTTCGGTTCAAAAC
GACAACCTGCAACAAGCAAGGATGGACCTTGCAGATGTCGAGGCAGACTTGAGAAGAAGCAATGAAGCCGTTGTA
CAATGCAAAGAAGAGCTCGAGGCCCATTGCAAGGCGGTGACGGTTTTGGAGACCAAGTTGCGCCGGGTGCGAGCC
GATATTGACCGGGTACAGGTGGAGTTGGATGAGTTTGAAGGCGTCGACGGGCGCCTCATGACTTTGCGGTCAGAA
CTTGAGAAGAAGCGGTCAGAAGAGAGGCAAGTGGGCAATCAATACGGCAAGATGAGGTTGGCCAAGCGCCATGTC
ACAACCAAGACGGATGAGGCCAAGGAAAAGCTGGAATCGCATAAACTGCGACTGGCAGACTTCAATAGCAAGGTC
AGCAAGGCCGACAAGAAGATTGCTACTCTCGAGGCGATGCGGCGCATTGCGGTTGCCGACAAGAATGCTGCACAC
GAGAGACTAGAAATGAAGAAAGCTGAGCGAGTCCGGGCCGAGGAGAAGCGTGACCGCCAGGCACAAGATGTAGAG
AATTTCATCAGTCAGGCGCAACAAGTGGCTCCAGAGCGAGTATATGTGCCCGATGGCGAAGACTATCGCAGCATC
GAGAACAAGTATGAAAAGATTGGCGAGCAGCTGGCCCAGCGTCAGGCCAGGCTTGGAGCCTCGGATCAGGAAATA
TACGACCGGGCCAATGAGGCTAGGACACGATATGAAGATGTCATGAAGCAAACCCGTGATGTGGACGAGACGGCT
GAGGCTCTGAAGCGGGCTATTGAGCACCGTCTTCACCTATGGCGACAATTTCAACGGCAGATCAGCGCTCGTGTC
CGCATCCAATTCAACTATCTGCTTAGCGAACGTGGCTTCAGGGGAAAAATCGACCTAAATCATCGTGCGCGAAAG
GTTATAATACACATTGAACCCGACGAGACACGAAAAAGCTCAGCCGGCCGCAGCACCAAAACATTATCTGGCGGC
GAGAAGTCATTCTCGTCTATTTGCATGCTTCTTTCCATTTGGGAAGCCATAGGGTCGCCTATTCGGTGTCTCGAC
GAGTTTGACGTCTTCATGGACAATGTCAATCGTGCCATCAGCACCAACATGCTTATTGATACAGCTCGACGTTCG
GTTTCTAGGCAGTACATTCTCATCACTCCCAATGCTATCGAGGGTCGAGCAAGGCTTGGTGATGATGTTAAAGTT
GTTCGCTTGACGGACCCGCGTCAACATACCCTTGTGTAA
Transcript >OphauB2|4674
ATGCCTATTAAACGAAACCGACCTGCTGCTATAGATGGCGACGAGGATGACGATGCCAGTGACGCGCTCCACTCG
TCTGCACATGCTAAAAAAAGAGCACGCATATCATTCGGTGAACATACATCAGATACGGGCGATTCTTGGCACTCC
CAGGACGACCATGACAATGGCGACCACGACGATGAGGATGAGGAAGTATTTGAGGACCGCGACGCTCATCCGCTG
ACACAGTACGAGATCATGCGAGATGCTGGCTTTCGTCATTTGAAGAACACGAAAATAGACGATTTGCGAGCGACA
CAAAAGCTTAAACAGCGGTCAGCCACCGTCAAACGAGGAAGTCTGATAGCAGAAAGCGGAATCATTGAAAGCATC
ACATGCTGTAACTTCATGTGTCATGATCGGCTCCACGTTCAGCTTGGTCCACTGATAAATTTCATTGTTGGAGAA
AACGGTAGCGGCAAAAGTGCTGTCTTGACAGCACTGACCCTTTGCTTGGGCGGCAAGGCTAGTGACACTAATCGG
GGGGGAAGCCTCAAGAGCTTTGTCAAGGAGGGACGGGACCATGGAAGTCTTAGTGTCAGAATCAAGAATTCCGGT
GCCGATTCCTATCACCATGACGTATATGGTAACACAATTGCCGTCGAGCGCCACTTTTCCAGAACGGGTAGCAGT
GGCTTCAAAATCAAATCAGAAACGGGTCGAATCATCTCGAATAAAAAGCAAGAAGTCGACGAAATATGTGAATGG
TATGCGCTGCAAATGGGCAATCCACTTACCGTCTTATCCCAGGATAACGCTCGCCAATTCCTCAACTCTGCAAGT
GACACACAAAAGTATAAGTACTTCGTTTCGGGTGTGCAGCTCGAACAACTTGATCACGACTACAAAATGTCTCAA
GACACGCTCGACAGGACCCTTACCTTGCGCAATGATCTCAATGAAAAGATAGGCTGTATCAAAAAGGAGATGCTC
GACGCTGAGAGATTGGCTGAGACTGTGCAAAAAAACCAGAGCATTCGAGACAAGGCCAGACTCTACCGTAACCAA
CTGGTATGGTTGCAGGTAGCAGAGCAAGAGCAAGAACTCGAGCGCCAAACCAAGGATTTGAACAGCCACGATGAA
ATGATTTCTCGAATGGAGCTCGAATGCGAGAACAGAGGAGAAGCCTTACATGGGGCAGAGGACAAGTTGCAACAA
GCCCGATTGCATCGAGAAAGCCTCGACGGGGAGCAAGGTTCCTTTGTCGAGAAAATAGAAGCAGCCGAAAATGCC
CATGATGCTGTTAACAGGGAGCTATCGGAGCTATGTCTCGAAGAACGGGATGCTTTTAGTCGTCTCAAGATATTC
AAATCAGAAATTGAGACCTGTGAGACAAGGATACAGCAAGAAGAAGAACGCTTGAACCAGTCTACCGGGCCTGAG
CGTATAGAAAAAGAGACAGAGCTATCACAGATAATGTCCTTGGAGGTAAAAATTGGCGAGCAACTCTCAGAGAAT
AAGTTGCACCGGCCTGTACTAGAATCTGGACTCGCCGAGGCAGAGCGGGCTCTTATTCAGCAACAAAAGCTCCGG
AATACCAAGTCCAACGACGTTGAGACAGCCAGAAGAAGAGTCAGAGATATTGAGCGAAGCACTGGCTCTATCTAT
GACGGCTTTGACCGAGACATAGCCAGCCTGGTAGGGGCGATACAGAATGACACAGGGTTCGAAAACAAGCCGGTT
GGACCCCTGGGCGTACATGTCAAGCTATTGAAGCCCGAATGGTCCGCGATTTTGGAAAAGATGTTTGGAGACGGA
TTAAACGCCTTTGTTGTCAGAAACAAACGCGATCAGTCCAGATTGTCGGCCTTGATGCATAGGATTGGACTGCAA
AAGTCGCCACCGATTTACATTGCCTATGGAGGACACATAGACACAAAGAGCCAAGAGCCTGATGAGCATTTTGAC
ACGGTTCTGCGCATTCTCGAGTTTGATGAGGATCTCGTTCGGACCCAACTCATCATCAATAGCCAGATAGAAAAG
ATCATTCTTGTCAAGGAACGTTTAGAAGCTGAGCGCATCATGATTGACAACGGACCACCTTGCAACGTGGCGGCT
TGTATCTGCTTTCACGATGGCAAAGGGAAACGTGGTCAAGGCTTGCGCATCACCAACCGGCAGGGGACTATCAGT
ACAAGCCCTATGCTGCCCAGCGTCTTGAAGCCCAGAATGCAATCCGAGGCGGGCAGACAACTTTCGGTTCAAAAC
GACAACCTGCAACAAGCAAGGATGGACCTTGCAGATGTCGAGGCAGACTTGAGAAGAAGCAATGAAGCCGTTGTA
CAATGCAAAGAAGAGCTCGAGGCCCATTGCAAGGCGGTGACGGTTTTGGAGACCAAGTTGCGCCGGGTGCGAGCC
GATATTGACCGGGTACAGGTGGAGTTGGATGAGTTTGAAGGCGTCGACGGGCGCCTCATGACTTTGCGGTCAGAA
CTTGAGAAGAAGCGGTCAGAAGAGAGGCAAGTGGGCAATCAATACGGCAAGATGAGGTTGGCCAAGCGCCATGTC
ACAACCAAGACGGATGAGGCCAAGGAAAAGCTGGAATCGCATAAACTGCGACTGGCAGACTTCAATAGCAAGGTC
AGCAAGGCCGACAAGAAGATTGCTACTCTCGAGGCGATGCGGCGCATTGCGGTTGCCGACAAGAATGCTGCACAC
GAGAGACTAGAAATGAAGAAAGCTGAGCGAGTCCGGGCCGAGGAGAAGCGTGACCGCCAGGCACAAGATGTAGAG
AATTTCATCAGTCAGGCGCAACAAGTGGCTCCAGAGCGAGTATATGTGCCCGATGGCGAAGACTATCGCAGCATC
GAGAACAAGTATGAAAAGATTGGCGAGCAGCTGGCCCAGCGTCAGGCCAGGCTTGGAGCCTCGGATCAGGAAATA
TACGACCGGGCCAATGAGGCTAGGACACGATATGAAGATGTCATGAAGCAAACCCGTGATGTGGACGAGACGGCT
GAGGCTCTGAAGCGGGCTATTGAGCACCGTCTTCACCTATGGCGACAATTTCAACGGCAGATCAGCGCTCGTGTC
CGCATCCAATTCAACTATCTGCTTAGCGAACGTGGCTTCAGGGGAAAAATCGACCTAAATCATCGTGCGCGAAAG
GTTATAATACACATTGAACCCGACGAGACACGAAAAAGCTCAGCCGGCCGCAGCACCAAAACATTATCTGGCGGC
GAGAAGTCATTCTCGTCTATTTGCATGCTTCTTTCCATTTGGGAAGCCATAGGGTCGCCTATTCGGTGTCTCGAC
GAGTTTGACGTCTTCATGGACAATGTCAATCGTGCCATCAGCACCAACATGCTTATTGATACAGCTCGACGTTCG
GTTTCTAGGCAGTACATTCTCATCACTCCCAATGCTATCGAGGGTCGAGCAAGGCTTGGTGATGATGTTAAAGTT
GTTCGCTTGACGGACCCGCGTCAACATACCCTTGTGTAA
Gene >OphauB2|4674
ATGCCTATTAAACGAAACCGACCTGCTGCTATAGATGGCGACGAGGATGACGATGCCAGTGACGCGCTCCACTCG
TCTGCACATGCTGTCAGTCTTCAGGGACTCTTTTGCTTGCCTGCGCCTTATTCTGACTCTTCAGGCATAGAAAAA
AAGAGCACGCATATCATTCGGTGAACATACATCAGATACGGGCGATTCTTGGCACTCCCAGGACGACCATGACAA
TGGCGACCACGACGATGAGGATGAGGAAGTATTTGAGGACCGCGACGCTCATCCGCTGACACAGTACGAGATCAT
GCGAGATGCTGGCTTTCGTCATTTGAAGAACACGAAAATAGACGATTTGCGAGCGACACAAAAGCTTAAACAGCG
GTCAGCCACCGTCAAACGAGGAAGTCTGATAGCAGAAAGCGGAATCATTGAAAGCATCACATGCTGTAACTTCAT
GTGTCATGATCGGCTCCACGTTCAGCTTGGTCCACTGATAAATTTCATTGTTGGAGAAAACGGTAGCGGCAAAAG
TGCTGTCTTGACAGCACTGACCCTTTGCTTGGGCGGCAAGGCTAGTGACACTAATCGGGGGGGAAGCCTCAAGAG
CTTTGTCAAGGAGGGACGGGACCATGGAAGTCTTAGTGTCAGAATCAAGAATTCCGGTGCCGATTCCTATCACCA
TGACGTATATGGTAACACAATTGCCGTCGAGCGCCACTTTTCCAGAACGGGTAGCAGTGGCTTCAAAATCAAATC
AGAAACGGGTCGAATCATCTCGAATAAAAAGCAAGAAGTCGACGAAATATGTGAATGGTATGCGCTGCAAATGGG
CAATCCACTTACCGTCTTATCCCAGGATAACGCTCGCCAATTCCTCAACTCTGCAAGTGACACACAAAAGTATAA
GTACTTCGTTTCGGGTGTGCAGCTCGAACAACTTGATCACGACTACAAAATGTCTCAAGACACGCTCGACAGGAC
CCTTACCTTGCGCAATGATCTCAATGAAAAGATAGGCTGTATCAAAAAGGAGATGCTCGACGCTGAGAGATTGGC
TGAGACTGTGCAAAAAAACCAGAGCATTCGAGACAAGGCCAGACTCTACCGTAACCAACTGGTATGGTTGCAGGT
AGCAGAGCAAGAGCAAGAACTCGAGCGCCAAACCAAGGATTTGAACAGCCACGATGAAATGATTTCTCGAATGGA
GCTCGAATGCGAGAACAGAGGAGAAGCCTTACATGGGGCAGAGGACAAGTTGCAACAAGCCCGATTGCATCGAGA
AAGCCTCGACGGGGAGCAAGGTTCCTTTGTCGAGAAAATAGAAGCAGCCGAAAATGCCCATGATGCTGTTAACAG
GGAGCTATCGGAGCTATGTCTCGAAGAACGGGATGCTTTTAGTCGTCTCAAGATATTCAAATCAGAAATTGAGAC
CTGTGAGACAAGGATACAGCAAGAAGAAGAACGCTTGAACCAGTCTACCGGGCCTGAGCGTATAGAAAAAGAGAC
AGAGCTATCACAGATAATGTCCTTGGAGGTAAAAATTGGCGAGCAACTCTCAGAGAATAAGTTGCACCGGCCTGT
ACTAGAATCTGGACTCGCCGAGGCAGAGCGGGCTCTTATTCAGCAACAAAAGCTCCGGAATACCAAGTCCAACGA
CGTTGAGACAGCCAGAAGAAGAGTCAGAGATATTGAGCGAAGCACTGGCTCTATCTATGACGGCTTTGACCGAGA
CATAGCCAGCCTGGTAGGGGCGATACAGAATGACACAGGGTTCGAAAACAAGCCGGTTGGACCCCTGGGCGTACA
TGTCAAGCTATTGAAGCCCGAATGGTCCGCGATTTTGGAAAAGATGTTTGGAGACGGATTAAACGCCTTTGTTGT
CAGAAACAAACGCGATCAGTCCAGATTGTCGGCCTTGATGCATAGGATTGGACTGCAAAAGTCGCCACCGATTTA
CATTGCCTATGGAGGACACATAGACACAAAGAGCCAAGAGCCTGATGAGCATTTTGACACGGTTCTGCGCATTCT
CGAGTTTGATGAGGATCTCGTTCGGACCCAACTCATCATCAATAGCCAGATAGAAAAGATCATTCTTGTCAAGGA
ACGTTTAGAAGCTGAGCGCATCATGATTGACAACGGACCACCTTGCAACGTGGCGGCTTGTATCTGCTTTCACGA
TGGCAAAGGGAAACGTGGTCAAGGCTTGCGCATCACCAACCGGCAGGGGACTATCAGTACAAGCCCTATGCTGCC
CAGCGTCTTGAAGCCCAGAATGCAATCCGAGGCGGGCAGACAACTTTCGGTTCAAAACGACAACCTGCAACAAGC
AAGGATGGACCTTGCAGATGTCGAGGCAGACTTGAGAAGAAGCAATGAAGCCGTTGTACAATGCAAAGAAGAGCT
CGAGGCCCATTGCAAGGCGGTGACGGTTTTGGAGACCAAGTTGCGCCGGGTGCGAGCCGATATTGACCGGGTACA
GGTGGAGTTGGATGAGTTTGAAGGCGTCGACGGGCGCCTCATGACTTTGCGGTCAGAACTTGAGAAGAAGCGGTC
AGAAGAGAGGCAAGTGGGCAATCAATACGGCAAGATGAGGTTGGCCAAGCGCCATGTCACAACCAAGACGGATGA
GGCCAAGGAAAAGCTGGAATCGCATAAACTGCGACTGGCAGACTTCAATAGCAAGGTCAGCAAGGCCGACAAGAA
GATTGCTACTCTCGAGGCGATGCGGCGCATTGCGGTTGCCGACAAGAATGCTGCACACGAGAGACTAGAAATGAA
GAAAGCTGAGCGAGTCCGGGCCGAGGAGAAGCGTGACCGCCAGGCACAAGATGTAGAGAATTTCATCAGTCAGGC
GCAACAAGTGGCTCCAGAGCGAGTATATGTGCCCGATGGCGAAGACTATCGCAGCATCGAGAACAAGTATGAAAA
GATTGGCGAGCAGCTGGCCCAGCGTCAGGCCAGGCTTGGAGCCTCGGATCAGGAAATATACGACCGGGCCAATGA
GGCTAGGACACGATATGAAGATGTCATGAAGCAAACCCGTGATGTGGACGAGACGGCTGAGGCTCTGAAGCGGGC
TATTGAGCACCGTCTTCACCTATGGCGACAATTTCAACGGCAGATCAGCGCTCGTGTCCGCATCCAATTCAACTA
TCTGCTTAGCGAACGTGGCTTCAGGGGAAAAATCGACCTAAATCATCGTGCGCGAAAGGTTATAATACACATTGA
ACCCGACGAGACACGAAAAAGCTCAGCCGGCCGCAGCACCAAAACATTATCTGGCGGCGAGAAGTCATTCTCGTC
TATTTGCATGCTTCTTTCCATTTGGGAAGCCATAGGGTCGCCTATTCGGTGTCTCGACGAGTTTGACGTCTTCAT
GGACAATGTCAATCGTGCCATCAGCACCAACATGCTTGTTAGTAGGATGTCTCATCCATCACGCGGCAATGGGGG
CTGACCAAGACGATACAAAATTCAGATTGATACAGCTCGACGTTCGGTTTCTAGGCAGTACATTCTCATCACTCC
CAATGCTATCGAGGGTCGAGCAAGGCTTGGTGATGATGTTAAAGTTGTTCGGTAAGTTTTTCGCTTGATGCACCT
AGAGCAGTCGGCGCTCGGGTTTCGGGTTGCAGTGACAGGAATGCAAACGCCTGCTGACATGAATGGTGCCATTAA
GCTTGACGGACCCGCGTCAACATACCCTTGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail