Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4671
Gene name
LocationContig_314:4876..6861
Strand-
Gene length (bp)1985
Transcript length (bp)1749
Coding sequence length (bp)1749
Protein length (aa) 583

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00262 Calreticulin Calreticulin family 8.3E-168 46 416

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Q487|CALX_ASPFU Calnexin homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G12850 PE=2 SV=2 1 513 0.0E+00
sp|D4AVD4|CALX_ARTBC Calnexin homolog ARB_00147 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00147 PE=3 SV=1 1 520 0.0E+00
sp|P36581|CALX_SCHPO Calnexin homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cal1 PE=1 SV=1 7 521 6.0E-144
sp|Q5R440|CALX_PONAB Calnexin OS=Pongo abelii GN=CANX PE=2 SV=2 35 434 2.0E-136
sp|P27824|CALX_HUMAN Calnexin OS=Homo sapiens GN=CANX PE=1 SV=2 35 434 5.0E-136
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Q487|CALX_ASPFU Calnexin homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G12850 PE=2 SV=2 1 513 0.0E+00
sp|D4AVD4|CALX_ARTBC Calnexin homolog ARB_00147 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00147 PE=3 SV=1 1 520 0.0E+00
sp|P36581|CALX_SCHPO Calnexin homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cal1 PE=1 SV=1 7 521 6.0E-144
sp|Q5R440|CALX_PONAB Calnexin OS=Pongo abelii GN=CANX PE=2 SV=2 35 434 2.0E-136
sp|P27824|CALX_HUMAN Calnexin OS=Homo sapiens GN=CANX PE=1 SV=2 35 434 5.0E-136
sp|P35565|CALX_RAT Calnexin OS=Rattus norvegicus GN=Canx PE=1 SV=1 40 434 1.0E-135
sp|P35564|CALX_MOUSE Calnexin OS=Mus musculus GN=Canx PE=1 SV=1 40 434 4.0E-135
sp|P24643|CALX_CANLF Calnexin OS=Canis lupus familiaris GN=CANX PE=1 SV=3 35 434 6.0E-135
sp|P29402|CALX1_ARATH Calnexin homolog 1 OS=Arabidopsis thaliana GN=CNX1 PE=1 SV=1 81 541 1.0E-123
sp|Q3SYT6|CLGN_BOVIN Calmegin OS=Bos taurus GN=CLGN PE=2 SV=1 46 440 8.0E-121
sp|E2RA18|CLGN_CANLF Calmegin OS=Canis lupus familiaris GN=CLGN PE=1 SV=2 30 434 1.0E-119
sp|O14967|CLGN_HUMAN Calmegin OS=Homo sapiens GN=CLGN PE=1 SV=1 46 434 2.0E-117
sp|P52194|CLGN_MOUSE Calmegin OS=Mus musculus GN=Clgn PE=1 SV=2 46 434 2.0E-117
sp|Q38798|CALX2_ARATH Calnexin homolog 2 OS=Arabidopsis thaliana GN=At5g07340 PE=2 SV=2 81 572 2.0E-115
sp|A8XA40|CALX_CAEBR Calnexin OS=Caenorhabditis briggsae GN=cnx-1 PE=3 SV=3 56 442 1.0E-110
sp|Q39994|CALX_HELTU Calnexin homolog OS=Helianthus tuberosus PE=2 SV=1 78 425 2.0E-109
sp|P34652|CALX_CAEEL Calnexin OS=Caenorhabditis elegans GN=cnx-1 PE=1 SV=1 58 442 3.0E-109
sp|O82709|CALX_PEA Calnexin homolog OS=Pisum sativum PE=2 SV=1 44 437 1.0E-103
sp|Q39817|CALX_SOYBN Calnexin homolog OS=Glycine max PE=2 SV=1 44 480 2.0E-100
sp|Q9STD3|CALR_CHLRE Calreticulin OS=Chlamydomonas reinhardtii PE=2 SV=1 46 439 2.0E-71
sp|Q23858|CALR_DICDI Calreticulin OS=Dictyostelium discoideum GN=crtA PE=1 SV=3 29 455 2.0E-71
sp|P52193|CALR_BOVIN Calreticulin OS=Bos taurus GN=CALR PE=1 SV=2 46 444 2.0E-69
sp|P28491|CALR_PIG Calreticulin OS=Sus scrofa GN=CALR PE=1 SV=3 46 444 2.0E-69
sp|Q8K3H7|CALR_CRIGR Calreticulin OS=Cricetulus griseus GN=CALR PE=1 SV=1 46 444 2.0E-69
sp|P27797|CALR_HUMAN Calreticulin OS=Homo sapiens GN=CALR PE=1 SV=1 46 444 2.0E-69
sp|P14211|CALR_MOUSE Calreticulin OS=Mus musculus GN=Calr PE=1 SV=1 46 444 3.0E-69
sp|Q4R6K8|CALR_MACFA Calreticulin OS=Macaca fascicularis GN=CALR PE=2 SV=1 46 444 3.0E-69
sp|Q2HWU3|CALR_MACFU Calreticulin OS=Macaca fuscata fuscata GN=CALR PE=2 SV=1 46 444 3.0E-69
sp|Q4VIT5|CALR_CHLAE Calreticulin OS=Chlorocebus aethiops GN=CALR PE=2 SV=1 46 444 3.0E-69
sp|P18418|CALR_RAT Calreticulin OS=Rattus norvegicus GN=Calr PE=1 SV=1 46 444 2.0E-68
sp|P15253|CALR_RABIT Calreticulin OS=Oryctolagus cuniculus GN=CALR PE=1 SV=1 46 444 2.0E-68
sp|P27798|CALR_CAEEL Calreticulin OS=Caenorhabditis elegans GN=crt-1 PE=3 SV=1 46 420 2.0E-66
sp|Q61KR9|CALR_CAEBR Calreticulin OS=Caenorhabditis briggsae GN=crt-1 PE=3 SV=1 46 420 4.0E-66
sp|Q9ZNY3|CALR_EUGGR Calreticulin OS=Euglena gracilis PE=2 SV=1 46 430 4.0E-64
sp|P93508|CALR_RICCO Calreticulin OS=Ricinus communis PE=2 SV=1 46 432 3.0E-61
sp|P11012|CALR_ONCVO Calreticulin OS=Onchocerca volvulus GN=crt-1 PE=2 SV=2 32 430 1.0E-60
sp|P29413|CALR_DROME Calreticulin OS=Drosophila melanogaster GN=Crc PE=1 SV=2 80 429 1.0E-59
sp|Q9XF98|CALR_PRUAR Calreticulin OS=Prunus armeniaca PE=2 SV=1 43 440 2.0E-59
sp|P27825|CALX_YEAST Calnexin homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNE1 PE=1 SV=1 46 434 4.0E-59
sp|Q9SLY8|CALR_ORYSJ Calreticulin OS=Oryza sativa subsp. japonica GN=Os07g0246200 PE=1 SV=2 46 443 7.0E-59
sp|O81919|CALR_BETVU Calreticulin OS=Beta vulgaris PE=2 SV=1 41 440 1.0E-58
sp|Q9ZPP1|CALR_BERST Calreticulin OS=Berberis stolonifera PE=2 SV=1 46 432 4.0E-58
sp|Q38858|CALR2_ARATH Calreticulin-2 OS=Arabidopsis thaliana GN=CRT2 PE=1 SV=3 46 432 7.0E-58
sp|Q7Z1E6|CALR_BOMMO Calreticulin OS=Bombyx mori GN=crt PE=1 SV=1 46 416 1.0E-57
sp|O04151|CALR1_ARATH Calreticulin-1 OS=Arabidopsis thaliana GN=CRT1 PE=1 SV=1 46 443 4.0E-56
sp|Q06814|CALR_SCHMA Calreticulin OS=Schistosoma mansoni PE=2 SV=2 97 465 1.0E-54
sp|Q40401|CALR_NICPL Calreticulin OS=Nicotiana plumbaginifolia GN=CAL1 PE=2 SV=1 46 432 4.0E-53
sp|Q9SP22|CALR_MAIZE Calreticulin OS=Zea mays GN=CRT PE=2 SV=1 46 442 6.0E-50
sp|O04153|CALR3_ARATH Calreticulin-3 OS=Arabidopsis thaliana GN=CRT3 PE=1 SV=2 32 451 1.0E-49
sp|Q9D9Q6|CALR3_MOUSE Calreticulin-3 OS=Mus musculus GN=Calr3 PE=1 SV=2 46 432 4.0E-39
sp|Q96L12|CALR3_HUMAN Calreticulin-3 OS=Homo sapiens GN=CALR3 PE=1 SV=2 46 432 2.0E-37
sp|Q2TBR8|CALR3_BOVIN Calreticulin-3 OS=Bos taurus GN=CALR3 PE=2 SV=1 46 432 3.0E-36
sp|Q9P7D0|YOFJ_SCHPO Uncharacterized protein P4H10.19c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP4H10.19c PE=3 SV=1 32 242 7.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0051082 unfolded protein binding Yes
GO:0005783 endoplasmic reticulum Yes
GO:0005509 calcium ion binding Yes
GO:0006457 protein folding Yes
GO:0043169 cation binding No
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:0043231 intracellular membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0043227 membrane-bounded organelle No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0043229 intracellular organelle No
GO:0005515 protein binding No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 494 516 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4671
MRFNAAVTAASAIVLAGVAHANDAQESPVVPVHVPTFTPTTLKAPFLEQFTDDWEQRWKPSHAKKDLKGSDKDDE
EWAYVGEWAVEEPTVYKGMEGDKGLVVKNPAAHHAISAKFPTKIDNKGKTLVVQYEVKLQNGLECGGAYMKLLRD
NKALHQDEFSNTTPYVIMFGPDKCGHTNKVHFIFNHKNPKTGEYEEKHLSSPPTAKIVKTTELYTLIVHPNNTYA
IKQNNKEVKTGSLLDDFSPAVNPPAEIDDPKDSKPDDWVDQARIPDPEAKKPDDWDEEAPFEIVDQEATMPEDWL
QDEPKTIADPDAEKPADWDDEEDGDWVAPTVANPKCADVSGCGSWTKPMKQNPDYKGKWSAPFVDNPDYKGPWAP
RKIKNPDFFEDKTPANFEPMGAIGFEIWTMQSDILFDNIYIGHSVEDADKFAQESWALKHPVEESLADKDKPKAE
DTPKSPSDLKFLDDPVVYMKEKLDLFMTIAREDPISAIKFVPEVAGGMVAVVVSLVALVVGLVGLGGSSPAVQKA
AGEAKVKAKEVADKAKEVAQEAADAAASGADKAKAEVASGVEKTKAEVNKRTTRSSS*
Coding >OphauB2|4671
ATGCGGTTCAACGCCGCTGTGACTGCGGCTTCGGCCATTGTGCTTGCAGGCGTCGCTCACGCCAACGATGCTCAA
GAGTCGCCCGTGGTGCCTGTACATGTGCCTACGTTTACGCCTACTACTCTCAAGGCTCCCTTTTTGGAGCAATTC
ACCGACGACTGGGAGCAGCGTTGGAAGCCCTCGCATGCCAAAAAGGACCTCAAGGGCTCCGACAAGGATGACGAG
GAGTGGGCGTACGTGGGTGAGTGGGCGGTTGAGGAGCCTACCGTCTACAAGGGCATGGAGGGCGACAAGGGCCTG
GTGGTGAAGAATCCGGCTGCTCACCACGCCATTTCGGCCAAATTCCCGACCAAGATTGACAACAAGGGCAAGACG
CTTGTTGTTCAGTACGAGGTGAAGCTTCAGAACGGTCTTGAGTGCGGCGGTGCGTACATGAAGCTCCTGCGCGAC
AACAAGGCCCTGCACCAGGACGAGTTTTCAAACACTACTCCCTATGTCATCATGTTTGGCCCCGACAAGTGTGGC
CACACCAACAAGGTGCACTTCATCTTCAACCACAAGAACCCCAAGACGGGCGAGTACGAGGAGAAGCACCTGTCG
TCTCCTCCCACGGCCAAGATTGTCAAGACGACGGAGCTGTATACCCTCATTGTCCACCCCAACAACACGTATGCC
ATTAAGCAGAACAACAAGGAGGTCAAGACGGGCTCCCTCCTCGACGACTTTTCTCCAGCCGTCAACCCGCCCGCC
GAGATTGACGACCCCAAGGACTCCAAGCCCGACGACTGGGTTGACCAGGCTCGCATCCCCGACCCCGAGGCTAAG
AAGCCCGACGACTGGGACGAGGAGGCGCCCTTTGAGATTGTTGACCAAGAGGCCACCATGCCCGAGGACTGGCTC
CAGGACGAGCCCAAGACCATTGCTGATCCTGATGCCGAGAAGCCCGCCGACTGGGACGACGAGGAAGATGGTGAC
TGGGTGGCGCCAACTGTTGCCAATCCCAAGTGCGCCGACGTGTCTGGCTGCGGCTCGTGGACCAAGCCCATGAAG
CAGAATCCCGACTACAAGGGCAAGTGGAGTGCGCCCTTTGTCGACAATCCCGACTACAAGGGGCCGTGGGCTCCT
CGCAAGATTAAGAATCCCGACTTTTTTGAGGATAAGACGCCGGCCAATTTTGAGCCCATGGGTGCTATTGGCTTT
GAAATCTGGACCATGCAAAGCGACATTCTCTTTGACAATATCTACATTGGCCACTCGGTGGAGGATGCCGACAAG
TTTGCCCAAGAGTCGTGGGCTCTCAAGCACCCTGTGGAGGAGAGCCTGGCGGACAAGGACAAGCCCAAGGCGGAG
GACACGCCCAAGTCGCCGTCTGACCTCAAGTTTTTGGACGACCCAGTTGTCTACATGAAGGAGAAGCTCGACTTG
TTTATGACTATTGCGCGCGAGGACCCCATTTCGGCCATCAAGTTTGTGCCCGAGGTTGCGGGCGGCATGGTTGCC
GTTGTGGTTAGTCTGGTGGCGCTGGTGGTTGGGCTGGTGGGCTTGGGAGGCTCGTCGCCGGCGGTGCAAAAGGCT
GCTGGCGAGGCCAAGGTCAAGGCCAAGGAGGTGGCGGACAAGGCCAAGGAGGTGGCTCAAGAGGCTGCCGACGCA
GCAGCCAGTGGTGCGGACAAGGCCAAGGCCGAGGTGGCGAGCGGAGTGGAAAAGACCAAGGCCGAGGTGAATAAG
CGGACTACGCGCAGCTCGTCGTGA
Transcript >OphauB2|4671
ATGCGGTTCAACGCCGCTGTGACTGCGGCTTCGGCCATTGTGCTTGCAGGCGTCGCTCACGCCAACGATGCTCAA
GAGTCGCCCGTGGTGCCTGTACATGTGCCTACGTTTACGCCTACTACTCTCAAGGCTCCCTTTTTGGAGCAATTC
ACCGACGACTGGGAGCAGCGTTGGAAGCCCTCGCATGCCAAAAAGGACCTCAAGGGCTCCGACAAGGATGACGAG
GAGTGGGCGTACGTGGGTGAGTGGGCGGTTGAGGAGCCTACCGTCTACAAGGGCATGGAGGGCGACAAGGGCCTG
GTGGTGAAGAATCCGGCTGCTCACCACGCCATTTCGGCCAAATTCCCGACCAAGATTGACAACAAGGGCAAGACG
CTTGTTGTTCAGTACGAGGTGAAGCTTCAGAACGGTCTTGAGTGCGGCGGTGCGTACATGAAGCTCCTGCGCGAC
AACAAGGCCCTGCACCAGGACGAGTTTTCAAACACTACTCCCTATGTCATCATGTTTGGCCCCGACAAGTGTGGC
CACACCAACAAGGTGCACTTCATCTTCAACCACAAGAACCCCAAGACGGGCGAGTACGAGGAGAAGCACCTGTCG
TCTCCTCCCACGGCCAAGATTGTCAAGACGACGGAGCTGTATACCCTCATTGTCCACCCCAACAACACGTATGCC
ATTAAGCAGAACAACAAGGAGGTCAAGACGGGCTCCCTCCTCGACGACTTTTCTCCAGCCGTCAACCCGCCCGCC
GAGATTGACGACCCCAAGGACTCCAAGCCCGACGACTGGGTTGACCAGGCTCGCATCCCCGACCCCGAGGCTAAG
AAGCCCGACGACTGGGACGAGGAGGCGCCCTTTGAGATTGTTGACCAAGAGGCCACCATGCCCGAGGACTGGCTC
CAGGACGAGCCCAAGACCATTGCTGATCCTGATGCCGAGAAGCCCGCCGACTGGGACGACGAGGAAGATGGTGAC
TGGGTGGCGCCAACTGTTGCCAATCCCAAGTGCGCCGACGTGTCTGGCTGCGGCTCGTGGACCAAGCCCATGAAG
CAGAATCCCGACTACAAGGGCAAGTGGAGTGCGCCCTTTGTCGACAATCCCGACTACAAGGGGCCGTGGGCTCCT
CGCAAGATTAAGAATCCCGACTTTTTTGAGGATAAGACGCCGGCCAATTTTGAGCCCATGGGTGCTATTGGCTTT
GAAATCTGGACCATGCAAAGCGACATTCTCTTTGACAATATCTACATTGGCCACTCGGTGGAGGATGCCGACAAG
TTTGCCCAAGAGTCGTGGGCTCTCAAGCACCCTGTGGAGGAGAGCCTGGCGGACAAGGACAAGCCCAAGGCGGAG
GACACGCCCAAGTCGCCGTCTGACCTCAAGTTTTTGGACGACCCAGTTGTCTACATGAAGGAGAAGCTCGACTTG
TTTATGACTATTGCGCGCGAGGACCCCATTTCGGCCATCAAGTTTGTGCCCGAGGTTGCGGGCGGCATGGTTGCC
GTTGTGGTTAGTCTGGTGGCGCTGGTGGTTGGGCTGGTGGGCTTGGGAGGCTCGTCGCCGGCGGTGCAAAAGGCT
GCTGGCGAGGCCAAGGTCAAGGCCAAGGAGGTGGCGGACAAGGCCAAGGAGGTGGCTCAAGAGGCTGCCGACGCA
GCAGCCAGTGGTGCGGACAAGGCCAAGGCCGAGGTGGCGAGCGGAGTGGAAAAGACCAAGGCCGAGGTGAATAAG
CGGACTACGCGCAGCTCGTCGTGA
Gene >OphauB2|4671
ATGCGGTTCAACGCCGCTGTGACTGCGGCTTCGGCCATTGTGCTTGCAGGCGTCGCTCACGCCAACGATGCTCAA
GAGTCGCCCGTGGTGCCTGTACATGTGCCTACGTTTACGGTGAGTCGACGACGACGGGGGGGGCTTCCACTGACG
AGCTTGGCTGGGCCTAGAGACTAATTGTTTGCTTTTTTTTGGGACGTGTGTGACTTAGCCTACTACTCTCAAGGC
TCCCTTTTTGGAGCAATTCACCGACGACTGGGAGCAGCGTTGGAAGCCCTCGCATGCCAAAAAGGACCTCAAGGG
CTCCGACAAGGATGACGAGGAGTGGGCGTACGTGGGTGAGTGGGCGGTTGAGGAGCCTACCGTCTACAAGGGCAT
GGAGGGCGACAAGGGCCTGGTGGTGAAGAATCCGGCTGCTCACCACGCCATTTCGGCCAAATTCCCGACCAAGAT
TGACAACAAGGGCAAGACGCTTGTTGTTCAGTACGAGGTGAAGCTTCAGAGTGAGTCGCAGCATGCAGACGCCTT
TGCCAACCATGGGGCATGCCAGAGACTAACACGGGCGTGTCCCTTGCAGACGGTCTTGAGTGCGGCGGTGCGTAC
ATGAAGCTCCTGCGCGACAACAAGGCCCTGCACCAGGACGAGTTTTCAAACACTACTCCCTATGTCATCATGTTT
GGCCCCGACAAGTGTGGCCACACCAACAAGGTGCACTTCATCTTCAACCACAAGAACCCCAAGACGGGCGAGTAC
GAGGAGAAGCACCTGTCGTCTCCTCCCACGGCCAAGATTGTCAAGACGACGGAGCTGTATACCCTCATTGTCCAC
CCCAACAACACGTATGCCATTAAGCAGAACAACAAGGAGGTCAAGACGGGCTCCCTCCTCGACGACTTTTCTCCA
GCCGTCAACCCGCCCGCCGAGATTGACGACCCCAAGGACTCCAAGCCCGACGACTGGGTTGACCAGGCTCGCATC
CCCGACCCCGAGGCTAAGAAGCCCGACGACTGGGACGAGGAGGCGCCCTTTGAGATTGTTGACCAAGAGGCCACC
ATGCCCGAGGACTGGCTCCAGGACGAGCCCAAGACCATTGCTGATCCTGATGCCGAGAAGCCCGCCGACTGGGAC
GACGAGGAAGATGGTGACTGGGTGGCGCCAACTGTTGCCAATCCCAAGTGCGCCGACGTGTCTGGCTGCGGCTCG
TGGACCAAGCCCATGAAGCAGAATCCCGACTACAAGGGCAAGTGGAGTGCGCCCTTTGTCGACAATCCCGACTAC
AAGGGGCCGTGGGCTCCTCGCAAGATTAAGAATCCCGACTTTTTTGAGGATAAGACGCCGGCCAATTTTGAGCCC
ATGGGTGCTGTAAGTTGCAAAACTGGGGAGACCAAGAGGTTTTGTCCAAAGTTTGTGCTGACGCGTGTCAATGTT
AGATTGGCTTTGAAATCTGGACCATGCAAAGCGACATTCTCTTTGACAATATCTACATTGGCCACTCGGTGGAGG
ATGCCGACAAGTTTGCCCAAGAGTCGTGGGCTCTCAAGCACCCTGTGGAGGAGAGCCTGGCGGACAAGGACAAGC
CCAAGGCGGAGGACACGCCCAAGTCGCCGTCTGACCTCAAGTTTTTGGACGACCCAGTTGTCTACATGAAGGAGA
AGCTCGACTTGTTTATGACTATTGCGCGCGAGGACCCCATTTCGGCCATCAAGTTTGTGCCCGAGGTTGCGGGCG
GCATGGTTGCCGTTGTGGTTAGTCTGGTGGCGCTGGTGGTTGGGCTGGTGGGCTTGGGAGGCTCGTCGCCGGCGG
TGCAAAAGGCTGCTGGCGAGGCCAAGGTCAAGGCCAAGGAGGTGGCGGACAAGGCCAAGGAGGTGGCTCAAGAGG
CTGCCGACGCAGCAGCCAGTGGTGCGGACAAGGCCAAGGCCGAGGTGGCGAGCGGAGTGGAAAAGACCAAGGCCG
AGGTGAATAAGCGGACTACGCGCAGCTCGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail