Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4669
Gene name
LocationContig_313:3468..6122
Strand-
Gene length (bp)2654
Transcript length (bp)2040
Coding sequence length (bp)2040
Protein length (aa) 680

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04059 RRM_2 RNA recognition motif 2 5.0E-21 466 519
PF04059 RRM_2 RNA recognition motif 2 6.6E-10 527 579

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P08965|MEI2_SCHPO Meiosis protein mei2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mei2 PE=1 SV=1 448 640 1.0E-49
sp|Q6ZI17|OML2_ORYSJ Protein MEI2-like 2 OS=Oryza sativa subsp. japonica GN=ML2 PE=2 SV=1 426 613 1.0E-32
sp|Q8W4I9|AML1_ARATH Protein MEI2-like 1 OS=Arabidopsis thaliana GN=ML1 PE=1 SV=1 454 617 6.0E-31
sp|Q75M35|OML3_ORYSJ Protein MEI2-like 3 OS=Oryza sativa subsp. japonica GN=ML3 PE=2 SV=2 433 617 7.0E-31
sp|Q64M78|OML4_ORYSJ Protein MEI2-like 4 OS=Oryza sativa subsp. japonica GN=ML4 PE=2 SV=1 454 613 9.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P08965|MEI2_SCHPO Meiosis protein mei2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mei2 PE=1 SV=1 448 640 1.0E-49
sp|Q6ZI17|OML2_ORYSJ Protein MEI2-like 2 OS=Oryza sativa subsp. japonica GN=ML2 PE=2 SV=1 426 613 1.0E-32
sp|Q8W4I9|AML1_ARATH Protein MEI2-like 1 OS=Arabidopsis thaliana GN=ML1 PE=1 SV=1 454 617 6.0E-31
sp|Q75M35|OML3_ORYSJ Protein MEI2-like 3 OS=Oryza sativa subsp. japonica GN=ML3 PE=2 SV=2 433 617 7.0E-31
sp|Q64M78|OML4_ORYSJ Protein MEI2-like 4 OS=Oryza sativa subsp. japonica GN=ML4 PE=2 SV=1 454 613 9.0E-31
sp|Q9LYN7|AML4_ARATH Protein MEI2-like 4 OS=Arabidopsis thaliana GN=ML4 PE=2 SV=1 454 617 1.0E-30
sp|Q8VWF5|AML5_ARATH Protein MEI2-like 5 OS=Arabidopsis thaliana GN=ML5 PE=1 SV=1 453 601 5.0E-29
sp|Q6EQX3|OML5_ORYSJ Protein MEI2-like 5 OS=Oryza sativa subsp. japonica GN=ML5 PE=2 SV=1 453 595 1.0E-27
sp|Q9SVV9|AML3_ARATH Protein MEI2-like 3 OS=Arabidopsis thaliana GN=ML3 PE=2 SV=2 454 603 4.0E-26
sp|Q9SJG8|AML2_ARATH Protein MEI2-like 2 OS=Arabidopsis thaliana GN=ML2 PE=2 SV=2 445 600 2.0E-21
sp|Q0JGS5|EAR1_ORYSJ Protein terminal ear1 homolog OS=Oryza sativa subsp. japonica GN=PLA2 PE=2 SV=1 464 595 2.0E-17
sp|A2WY46|EAR1_ORYSI Protein terminal ear1 homolog OS=Oryza sativa subsp. indica GN=PLA2 PE=2 SV=1 464 595 2.0E-17
sp|O65001|TE1_MAIZE Protein terminal ear1 OS=Zea mays GN=TE1 PE=2 SV=1 463 592 4.0E-17
sp|Q6ET49|OML7_ORYSJ Protein MEI2-like 7 OS=Oryza sativa subsp. japonica GN=OML7 PE=2 SV=1 467 595 2.0E-09
sp|Q652K6|OML6_ORYSJ Protein MEI2-like 6 OS=Oryza sativa subsp. japonica GN=ML6 PE=2 SV=1 467 595 1.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4981
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7951
Ophiocordyceps australis map64 (Brazil) OphauB2|4669 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04256
Ophiocordyceps camponoti-rufipedis Ophun1|4716
Ophiocordyceps kimflemingae Ophio5|8617
Ophiocordyceps subramaniannii Hirsu2|2180

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4669
MAQVRERDNPSSPRSSCGAADSFKGTPETRLTAFSPEDGSAKSSKLLHGLARSASATPPVGRPLTSFCGSATHID
KDPFVTPSHQPGTRLSPTASTFSPFSTSLKVGRAFDAAPIAAALSSDLGLSRHLHVSSSAHLSVTEVNTWLSELE
ARGDPPCGARFSDPLDGQVCVHFSDIRDARSTTASARHAGKDWKVEYLDPSQLAKYGLACRDSKRCSSGQVDVLA
AVPQGTALDVIQAMEAVQRLLQCNGRLFAFVRRSTFPNGSFKAMAEFCDASAAELAASSLGNIITSEGIHLLVSP
HLIELSDGPSIMEAFQSLSMGRGRSGVDQHQAPDTTASRLAGPMDMRIHPTFAMYPLMFQPQFAAAPTGMSYVLD
SFIPSGTQGPMTPMAPVSPSYSVAGPLYHTPPSPALTSQNSFSPSRSLTDFGRSDARRQHAMRINRSPYHNVASH
HNHVDILRIRDGIDVRTTIMLRNIPNKVDQAMLKRIIDESSWGKYDFMYLRIDFANDCNVGYAFINFVDVGVWPP
AVGFALTMMQPLDIIDKFVDARGNQRWNCFKSDKVAEISYATIQGKDCLVQKFRNSSVMLEAPHYRPKLYFTSNG
PMPELAGQEEPFPEPDNQSKMKRSCENAEHVGLFTPNAGQHFRDEQRRRRSQYDRGTRLAALEEYDYETAIQNLY
GTPT*
Coding >OphauB2|4669
ATGGCCCAAGTTCGGGAGCGCGACAATCCATCGTCGCCGAGATCCTCGTGCGGCGCGGCCGACTCTTTCAAAGGT
ACACCAGAGACACGTCTGACAGCCTTTTCTCCCGAAGATGGCTCGGCCAAGTCATCCAAGCTTCTCCATGGACTT
GCCCGCTCCGCTTCTGCAACACCACCTGTGGGTCGACCTCTGACCAGTTTCTGTGGCTCTGCCACTCATATCGAC
AAGGATCCCTTCGTCACTCCCTCCCACCAGCCTGGTACCCGGCTGTCCCCGACTGCGTCGACCTTCAGCCCATTT
TCGACATCTCTCAAAGTTGGTCGGGCCTTCGACGCTGCTCCCATCGCCGCTGCTTTGAGCAGCGACTTGGGTTTG
TCTCGACATCTGCATGTATCCTCCTCTGCTCACTTGTCCGTGACCGAGGTCAATACTTGGCTAAGTGAGCTAGAA
GCTCGCGGCGATCCTCCTTGCGGAGCTCGCTTCTCAGACCCATTGGACGGCCAAGTTTGCGTTCATTTCTCGGAT
ATTCGAGATGCACGTTCTACCACTGCCAGCGCTCGCCACGCGGGAAAAGACTGGAAGGTCGAATATCTCGATCCA
TCCCAGCTAGCAAAGTACGGTTTGGCTTGTCGAGATTCAAAGCGATGCTCAAGTGGTCAAGTGGATGTTCTCGCC
GCTGTCCCACAGGGCACTGCACTCGATGTGATCCAAGCCATGGAAGCAGTTCAGAGGCTTCTCCAATGCAACGGG
CGCCTCTTCGCATTTGTCAGGCGGTCTACATTTCCAAATGGATCTTTCAAGGCCATGGCAGAATTCTGTGATGCG
AGCGCTGCTGAGCTGGCGGCTTCGAGCTTGGGAAATATCATCACCTCAGAGGGCATTCATCTTCTCGTCTCCCCG
CACCTGATTGAATTATCAGACGGTCCCAGCATTATGGAAGCATTTCAAAGCTTGTCCATGGGCAGAGGTCGGAGC
GGTGTAGACCAGCATCAAGCACCTGACACGACTGCATCAAGGCTCGCGGGGCCTATGGACATGAGAATTCACCCT
ACCTTTGCCATGTACCCGCTCATGTTCCAACCACAGTTTGCTGCGGCTCCGACCGGAATGTCCTATGTGTTGGAT
TCATTTATTCCCTCTGGAACCCAGGGCCCCATGACTCCCATGGCACCGGTCTCGCCATCGTACTCGGTCGCGGGC
CCGCTGTACCACACACCTCCGTCTCCTGCTCTGACATCCCAAAACAGCTTCAGTCCATCCAGATCGCTCACCGAC
TTTGGTAGGTCGGATGCTCGAAGGCAGCACGCGATGCGCATCAATAGGTCTCCGTATCATAATGTGGCGAGCCAT
CACAACCATGTTGACATTCTTCGTATTCGAGATGGTATAGATGTTCGTACCACGATCATGTTACGAAATATCCCC
AATAAGGTTGATCAGGCGATGCTCAAGCGAATAATTGACGAATCAAGCTGGGGCAAATACGATTTCATGTACCTA
CGCATCGACTTTGCTAATGACTGCAACGTTGGCTATGCATTTATCAACTTCGTTGACGTGGGTGTTTGGCCTCCT
GCTGTTGGATTTGCGCTAACTATGATGCAGCCACTTGACATTATCGACAAGTTTGTGGATGCCAGGGGCAACCAG
CGCTGGAACTGTTTCAAGAGCGACAAGGTAGCAGAAATATCATATGCAACCATACAAGGCAAGGATTGTCTCGTC
CAGAAGTTTCGAAATAGCTCCGTAATGCTCGAGGCACCTCATTATCGACCAAAGCTGTACTTTACTTCGAATGGC
CCCATGCCAGAATTGGCCGGCCAAGAAGAGCCATTTCCAGAGCCAGACAACCAGTCCAAAATGAAAAGAAGTTGC
GAAAACGCAGAGCATGTCGGCCTGTTCACTCCCAATGCAGGACAGCACTTTCGTGACGAGCAACGACGTCGGCGC
TCACAATACGACAGAGGCACTCGGCTTGCGGCCCTCGAAGAATACGACTACGAAACGGCTATCCAGAACCTCTAC
GGCACGCCAACATGA
Transcript >OphauB2|4669
ATGGCCCAAGTTCGGGAGCGCGACAATCCATCGTCGCCGAGATCCTCGTGCGGCGCGGCCGACTCTTTCAAAGGT
ACACCAGAGACACGTCTGACAGCCTTTTCTCCCGAAGATGGCTCGGCCAAGTCATCCAAGCTTCTCCATGGACTT
GCCCGCTCCGCTTCTGCAACACCACCTGTGGGTCGACCTCTGACCAGTTTCTGTGGCTCTGCCACTCATATCGAC
AAGGATCCCTTCGTCACTCCCTCCCACCAGCCTGGTACCCGGCTGTCCCCGACTGCGTCGACCTTCAGCCCATTT
TCGACATCTCTCAAAGTTGGTCGGGCCTTCGACGCTGCTCCCATCGCCGCTGCTTTGAGCAGCGACTTGGGTTTG
TCTCGACATCTGCATGTATCCTCCTCTGCTCACTTGTCCGTGACCGAGGTCAATACTTGGCTAAGTGAGCTAGAA
GCTCGCGGCGATCCTCCTTGCGGAGCTCGCTTCTCAGACCCATTGGACGGCCAAGTTTGCGTTCATTTCTCGGAT
ATTCGAGATGCACGTTCTACCACTGCCAGCGCTCGCCACGCGGGAAAAGACTGGAAGGTCGAATATCTCGATCCA
TCCCAGCTAGCAAAGTACGGTTTGGCTTGTCGAGATTCAAAGCGATGCTCAAGTGGTCAAGTGGATGTTCTCGCC
GCTGTCCCACAGGGCACTGCACTCGATGTGATCCAAGCCATGGAAGCAGTTCAGAGGCTTCTCCAATGCAACGGG
CGCCTCTTCGCATTTGTCAGGCGGTCTACATTTCCAAATGGATCTTTCAAGGCCATGGCAGAATTCTGTGATGCG
AGCGCTGCTGAGCTGGCGGCTTCGAGCTTGGGAAATATCATCACCTCAGAGGGCATTCATCTTCTCGTCTCCCCG
CACCTGATTGAATTATCAGACGGTCCCAGCATTATGGAAGCATTTCAAAGCTTGTCCATGGGCAGAGGTCGGAGC
GGTGTAGACCAGCATCAAGCACCTGACACGACTGCATCAAGGCTCGCGGGGCCTATGGACATGAGAATTCACCCT
ACCTTTGCCATGTACCCGCTCATGTTCCAACCACAGTTTGCTGCGGCTCCGACCGGAATGTCCTATGTGTTGGAT
TCATTTATTCCCTCTGGAACCCAGGGCCCCATGACTCCCATGGCACCGGTCTCGCCATCGTACTCGGTCGCGGGC
CCGCTGTACCACACACCTCCGTCTCCTGCTCTGACATCCCAAAACAGCTTCAGTCCATCCAGATCGCTCACCGAC
TTTGGTAGGTCGGATGCTCGAAGGCAGCACGCGATGCGCATCAATAGGTCTCCGTATCATAATGTGGCGAGCCAT
CACAACCATGTTGACATTCTTCGTATTCGAGATGGTATAGATGTTCGTACCACGATCATGTTACGAAATATCCCC
AATAAGGTTGATCAGGCGATGCTCAAGCGAATAATTGACGAATCAAGCTGGGGCAAATACGATTTCATGTACCTA
CGCATCGACTTTGCTAATGACTGCAACGTTGGCTATGCATTTATCAACTTCGTTGACGTGGGTGTTTGGCCTCCT
GCTGTTGGATTTGCGCTAACTATGATGCAGCCACTTGACATTATCGACAAGTTTGTGGATGCCAGGGGCAACCAG
CGCTGGAACTGTTTCAAGAGCGACAAGGTAGCAGAAATATCATATGCAACCATACAAGGCAAGGATTGTCTCGTC
CAGAAGTTTCGAAATAGCTCCGTAATGCTCGAGGCACCTCATTATCGACCAAAGCTGTACTTTACTTCGAATGGC
CCCATGCCAGAATTGGCCGGCCAAGAAGAGCCATTTCCAGAGCCAGACAACCAGTCCAAAATGAAAAGAAGTTGC
GAAAACGCAGAGCATGTCGGCCTGTTCACTCCCAATGCAGGACAGCACTTTCGTGACGAGCAACGACGTCGGCGC
TCACAATACGACAGAGGCACTCGGCTTGCGGCCCTCGAAGAATACGACTACGAAACGGCTATCCAGAACCTCTAC
GGCACGCCAACATGA
Gene >OphauB2|4669
ATGGCCCAAGTTCGGGAGCGCGACAATCCATCGTCGCCGAGATCCTCGTGCGGCGCGGCCGACTCTTTCAAAGGT
ACACCAGAGACACGTCTGACAGCCTTTTCTCCCGAAGATGGCTCGGCCAAGTCATCCAAGCTTCTCCATGGACTT
GCCCGCTCCGCTTCTGCAACACCACCTGTGGGTCGACCTCTGACCAGTTTCTGTGGCTCTGCCACTCATATCGAC
AAGGATCCCTTCGTCACTCCCTCCCACCAGCCTGGTACCCGGCTGTCCCCGACTGCGTCGACCTTCAGCCCATTT
TCGACATCTCTCAAAGTTGGTCGGGCCTTCGACGCTGCTCCCATCGCCGCTGCTTTGAGCAGCGACTTGGGTTTG
TCTCGACATCTGCATGTATCCTCCTCTGCTCACTTGTCCGTGACCGAGGTCAATACTTGGCTAAGTGTATTTGCC
TTGATGATTTACGTCCTCATGATATTGACAATACTGACCAAGCTCATCACTCCCAGGAGCTAGAAGCTCGCGGCG
ATCCTCCTTGCGGAGCTCGCTTCTCAGACCCATTGGACGGCCAAGTTTGCGTTCATTTCTCGGATATTCGAGATG
CACGTTCTACCACTGCCAGCGCTCGCCACGCGGGAAAAGACTGGAAGGTCGAATATCTCGATCCATCCCAGCTAG
CAAAGGTGAGATTTGCCAGTTGTGGTTCTGATTCTTGTTACCCCACTAACCGGCACCTATCTTTGGCTTGGGCAG
TACGGTTTGGCTTGTCGAGATTCAAAGCGATGCTCAAGTGGTCAAGTGGATGTTCTCGCCGCTGTCCCACAGGGC
ACTGCACTCGATGTGATCCAAGCCATGGAAGCAGTTCAGAGGCTTCTCCAATGCAACGGGCGCCTCTTCGCATTT
GTCAGGCGGTCTACATTTCCAAATGGATCTTTCAAGGCCATGGCAGAATTCTGTGATGCGAGCGCTGCTGAGCTG
GCGGCTTCGAGCTTGGGAAATATCATCACCTCAGAGGTACCATCAATTTATGCTTCATTTTTCATCATTTGCATT
TGTTTCCTGACTATCTTGTAAAGGGCATTCATCTTCTCGTCTCCCCGCACCTGATTGAATTATCAGACGGTCCCA
GCATTATGGAAGCATTTCAAAGCTTGTCCATGGGCAGAGGTCGGAGCGGTGTAGACCAGCATCAAGCACCTGACA
CGACTGCATCAAGGCTCGCGGGGCCTATGGACATGAGAATTCACCCTACCTTTGCCATGTACCCGCTCATGTTCC
AACCACAGTTTGCTGCGGCTCCGACCGGAATGTCCTATGTGTTGGATTCATTTATTCCCTCTGGAACCCAGGGCC
CCATGACTCCCATGGCACCGGTCTCGCCATCGTACTCGGTCGCGGGCCCGCTGTACCACACACCTCCGTCTCCTG
CTCTGACATCCCAAAACAGCTTCAGTCCATCCAGATCGCTCACCGACTTTGGTAGGTCGGATGCTCGAAGGCAGC
ACGCGATGCGCATCAATAGGTCTCCGTATCATAATGTGGCGAGCCATCACAACCATGTTGACATTCTTCGTATTC
GAGATGGTATAGATGTTCGTACCACGGTCTGTCTCACTGTTCACTTGTCTTGGTGGCAAAATAAATCGACTCACA
TTGACACTAGATCATGTTACGAAATATCCCCAATAAGGTTGATCAGGCGATGCTCAAGCGAATAATTGACGAATC
AAGCTGGGGCAAATACGATTTCATGTACCTACGCATCGACTTTGCTAATGACTGCAAGTCAGTAGCAGACTATTT
CCGTCCTCTAGTTCTAATGGGCTGACTGTATTGAAACAGCGTTGGCTATGCATTTATCAACTTCGTTGACGTGGG
TGTTTGGCCTCCTGCTGTTGGATTTGCGCTAACTATGATGCAGCCACTTGACATTATCGACGTTGGTCCAATCCC
CCCCCCTTTTTTTTTCATCAACACAACGATTTGCATAAGCTAACTCTGGAGAAGTTTGTGGATGCCAGGGGCAAC
CAGCGCTGGTAAGTTCAAATGCACTATTGAAAATACATTTTAAATTAACATGCGTAGGAACTGTTTCAAGAGCGA
CAAGGTAGCAGAAATATCATATGCAAGTGAGTTGCTCGTTGCTGCAATATAGTATACAATGATGACGAACAGGAT
GCAGCCATACAAGGCAAGGATTGTCTCGTCCAGAAGTTTCGAAATAGCTCCGTAATGCTCGAGGCACCTCATTAT
CGACCAAAGGTGAGTCTATAATGAAGCATTGGAAAATGCTCCCAAGTGGCTGCTGGTATGCTAACAATATGGATG
TTTTAGCTGTACTTTACTTCGAATGGCCCCATGCCAGAATTGGCCGGCCAAGAAGAGCCATTTCCAGAGCCAGAC
AACCAGTCCAAAATGAAAAGAAGTTGCGAAAACGCAGAGCATGTCGGCAAGTACTTTGATTAATTCATTTACGCT
GCGTAGTACCCAGGCAGGGCTAACATTATTCAGGCCTGTTCACTCCCAATGCAGGACAGCACTTTCGTGACGAGC
AACGACGTCGGCGCTCACAATACGACAGAGGCACTCGGCTTGCGGCCCTCGAAGAATACGACTACGAAACGGCTA
TCCAGAACCTCTACGGCACGCCAACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail