Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4650
Gene name
LocationContig_31:126909..128118
Strand-
Gene length (bp)1209
Transcript length (bp)1065
Coding sequence length (bp)1065
Protein length (aa) 355

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 1.2E-09 23 73
PF04193 PQ-loop PQ loop repeat 1.0E-11 175 228

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14166|YDX3_SCHPO Uncharacterized protein C4C5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4C5.03 PE=4 SV=1 13 267 4.0E-31

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 20 38 18
2 51 73 22
3 98 120 22
4 141 163 22
5 173 195 22
6 202 224 22
7 234 256 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4650
MELLPVSRAECEPLKTPSYLELVISLLILVGLLVSYLPQHYRIISRGTSEGISPYFVLLGTTSATAGFANILTVP
PSRTALSCCKELDGFECGAALLGVAQLGMQWLCFVFILVLFLIFFRYREANVPQEQLRGTSPRWQTAVMVGLVCV
LHGLAIIIVTAVFAMARPSHLDAWANAMGVMAAMLAAIQYVPQIWTTYHLKHVGSLSIPMMCIQTPGGFLFAGSL
FARLGPAGWSTWAIYLLTATMQGTVLVLGVYYEIAARRLHDDTLSAPPSPLARSSLARRPHASRTYSEGWERGLP
GPFTGHPERYAETEDDLDHMREREERAVARESQPLLRPGGIGNPHKHYDSETYG*
Coding >OphauB2|4650
ATGGAGTTGCTGCCGGTCTCGAGGGCCGAGTGCGAGCCCCTCAAGACGCCGTCATATCTTGAGCTTGTCATTTCT
CTCCTTATCCTCGTTGGTCTCTTGGTTTCCTACCTGCCGCAGCACTACCGCATCATCTCGCGCGGCACGTCCGAG
GGCATCTCGCCCTACTTTGTCCTGCTCGGCACCACGTCTGCCACGGCGGGCTTTGCTAATATACTGACGGTTCCG
CCCTCACGCACCGCCCTAAGTTGCTGCAAAGAGCTGGATGGGTTTGAGTGCGGAGCAGCGCTACTGGGCGTGGCT
CAGCTGGGCATGCAGTGGCTTTGTTTTGTCTTCATCCTCGTCCTCTTCCTCATCTTCTTCCGCTATCGAGAAGCC
AATGTACCTCAGGAGCAACTACGCGGCACATCGCCCAGGTGGCAGACGGCCGTCATGGTTGGACTGGTGTGCGTG
CTGCACGGGCTGGCCATCATCATCGTCACGGCCGTCTTTGCCATGGCGCGGCCCAGCCACCTCGACGCCTGGGCC
AACGCCATGGGCGTCATGGCCGCCATGCTCGCCGCCATCCAGTACGTGCCGCAAATCTGGACCACGTACCATCTC
AAGCACGTGGGCAGCCTCAGCATCCCCATGATGTGCATCCAGACGCCCGGCGGCTTCCTCTTTGCCGGCAGCCTG
TTTGCCCGCCTGGGCCCTGCCGGCTGGAGCACTTGGGCCATCTATCTCTTGACGGCCACCATGCAGGGCACCGTG
CTCGTCCTCGGTGTCTACTACGAGATTGCCGCCCGCCGCCTCCACGACGACACCCTAAGCGCGCCGCCTTCGCCT
CTGGCCCGTTCGAGCCTCGCCCGCCGCCCACACGCAAGCCGAACCTACTCCGAGGGCTGGGAACGAGGCCTGCCT
GGCCCCTTTACAGGCCACCCTGAGCGCTATGCCGAGACGGAGGACGACCTTGATCACATGCGTGAGCGCGAGGAG
CGCGCCGTCGCCCGGGAATCTCAACCATTGCTCCGTCCAGGCGGCATTGGCAACCCACACAAGCACTACGACTCG
GAAACATATGGCTAG
Transcript >OphauB2|4650
ATGGAGTTGCTGCCGGTCTCGAGGGCCGAGTGCGAGCCCCTCAAGACGCCGTCATATCTTGAGCTTGTCATTTCT
CTCCTTATCCTCGTTGGTCTCTTGGTTTCCTACCTGCCGCAGCACTACCGCATCATCTCGCGCGGCACGTCCGAG
GGCATCTCGCCCTACTTTGTCCTGCTCGGCACCACGTCTGCCACGGCGGGCTTTGCTAATATACTGACGGTTCCG
CCCTCACGCACCGCCCTAAGTTGCTGCAAAGAGCTGGATGGGTTTGAGTGCGGAGCAGCGCTACTGGGCGTGGCT
CAGCTGGGCATGCAGTGGCTTTGTTTTGTCTTCATCCTCGTCCTCTTCCTCATCTTCTTCCGCTATCGAGAAGCC
AATGTACCTCAGGAGCAACTACGCGGCACATCGCCCAGGTGGCAGACGGCCGTCATGGTTGGACTGGTGTGCGTG
CTGCACGGGCTGGCCATCATCATCGTCACGGCCGTCTTTGCCATGGCGCGGCCCAGCCACCTCGACGCCTGGGCC
AACGCCATGGGCGTCATGGCCGCCATGCTCGCCGCCATCCAGTACGTGCCGCAAATCTGGACCACGTACCATCTC
AAGCACGTGGGCAGCCTCAGCATCCCCATGATGTGCATCCAGACGCCCGGCGGCTTCCTCTTTGCCGGCAGCCTG
TTTGCCCGCCTGGGCCCTGCCGGCTGGAGCACTTGGGCCATCTATCTCTTGACGGCCACCATGCAGGGCACCGTG
CTCGTCCTCGGTGTCTACTACGAGATTGCCGCCCGCCGCCTCCACGACGACACCCTAAGCGCGCCGCCTTCGCCT
CTGGCCCGTTCGAGCCTCGCCCGCCGCCCACACGCAAGCCGAACCTACTCCGAGGGCTGGGAACGAGGCCTGCCT
GGCCCCTTTACAGGCCACCCTGAGCGCTATGCCGAGACGGAGGACGACCTTGATCACATGCGTGAGCGCGAGGAG
CGCGCCGTCGCCCGGGAATCTCAACCATTGCTCCGTCCAGGCGGCATTGGCAACCCACACAAGCACTACGACTCG
GAAACATATGGCTAG
Gene >OphauB2|4650
ATGGAGTTGCTGCCGGTCTCGAGGGCCGAGTGCGAGCCCCTCAAGACGCCGTCATATCTTGAGCTTGTCATTTCT
CTGTGCGTTGTCTAGCATCTTGACTGACTGGTGGATGAGCAAAAGAGACAGTCACACTGACATGTGGGGGGCTTA
GCCTTATCCTCGTTGGTCTCTTGGTTTCCTACCTGCCGCAGCACTACCGCATCATCTCGCGCGGCACGTCCGAGG
GCATCTCGCCCTACTTTGTCCTGCTCGGCACCACGTCTGCCACGGCGGGCTTTGCTAATATACTGACGGTTCCGC
CCTCACGCACCGCCCTAAGTTGCTGCAAAGAGCTGGATGGGTTTGAGTGCGGAGCAGCGCTACTGGGCGTGGCTC
AGCTGGGCATGCAGTGGCTTTGTTTTGTCTTCATGTAAGCCATGGTGTGCATGGTGGCTTGTCGGACCTTTGTTG
CATTCCTGCCTGCTGACAAGCCACATCAGCCTCGTCCTCTTCCTCATCTTCTTCCGCTATCGAGAAGCCAATGTA
CCTCAGGAGCAACTACGCGGCACATCGCCCAGGTGGCAGACGGCCGTCATGGTTGGACTGGTGTGCGTGCTGCAC
GGGCTGGCCATCATCATCGTCACGGCCGTCTTTGCCATGGCGCGGCCCAGCCACCTCGACGCCTGGGCCAACGCC
ATGGGCGTCATGGCCGCCATGCTCGCCGCCATCCAGTACGTGCCGCAAATCTGGACCACGTACCATCTCAAGCAC
GTGGGCAGCCTCAGCATCCCCATGATGTGCATCCAGACGCCCGGCGGCTTCCTCTTTGCCGGCAGCCTGTTTGCC
CGCCTGGGCCCTGCCGGCTGGAGCACTTGGGCCATCTATCTCTTGACGGCCACCATGCAGGGCACCGTGCTCGTC
CTCGGTGTCTACTACGAGATTGCCGCCCGCCGCCTCCACGACGACACCCTAAGCGCGCCGCCTTCGCCTCTGGCC
CGTTCGAGCCTCGCCCGCCGCCCACACGCAAGCCGAACCTACTCCGAGGGCTGGGAACGAGGCCTGCCTGGCCCC
TTTACAGGCCACCCTGAGCGCTATGCCGAGACGGAGGACGACCTTGATCACATGCGTGAGCGCGAGGAGCGCGCC
GTCGCCCGGGAATCTCAACCATTGCTCCGTCCAGGCGGCATTGGCAACCCACACAAGCACTACGACTCGGAAACA
TATGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail