Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4646
Gene name
LocationContig_31:114510..118138
Strand-
Gene length (bp)3628
Transcript length (bp)3444
Coding sequence length (bp)3444
Protein length (aa) 1148

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10433 MMS1_N Mono-functional DNA-alkylating methyl methanesulfonate N-term 1.2E-96 73 572
PF03178 CPSF_A CPSF A subunit region 5.0E-56 785 1116

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6QNU4|DDB1_SOLLC DNA damage-binding protein 1 OS=Solanum lycopersicum GN=DDB1 PE=1 SV=1 2 1147 2.0E-113
sp|Q6E7D1|DDB1_SOLCE DNA damage-binding protein 1 OS=Solanum cheesmaniae GN=DDB1 PE=3 SV=1 2 1147 6.0E-113
sp|Q9M0V3|DDB1A_ARATH DNA damage-binding protein 1a OS=Arabidopsis thaliana GN=DDB1A PE=1 SV=1 2 1147 7.0E-113
sp|O49552|DDB1B_ARATH DNA damage-binding protein 1b OS=Arabidopsis thaliana GN=DDB1B PE=2 SV=2 2 1147 1.0E-110
sp|Q3U1J4|DDB1_MOUSE DNA damage-binding protein 1 OS=Mus musculus GN=Ddb1 PE=1 SV=2 2 1147 3.0E-100
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6QNU4|DDB1_SOLLC DNA damage-binding protein 1 OS=Solanum lycopersicum GN=DDB1 PE=1 SV=1 2 1147 2.0E-113
sp|Q6E7D1|DDB1_SOLCE DNA damage-binding protein 1 OS=Solanum cheesmaniae GN=DDB1 PE=3 SV=1 2 1147 6.0E-113
sp|Q9M0V3|DDB1A_ARATH DNA damage-binding protein 1a OS=Arabidopsis thaliana GN=DDB1A PE=1 SV=1 2 1147 7.0E-113
sp|O49552|DDB1B_ARATH DNA damage-binding protein 1b OS=Arabidopsis thaliana GN=DDB1B PE=2 SV=2 2 1147 1.0E-110
sp|Q3U1J4|DDB1_MOUSE DNA damage-binding protein 1 OS=Mus musculus GN=Ddb1 PE=1 SV=2 2 1147 3.0E-100
sp|P33194|DDB1_CHLAE DNA damage-binding protein 1 OS=Chlorocebus aethiops GN=DDB1 PE=1 SV=1 2 1147 9.0E-100
sp|Q16531|DDB1_HUMAN DNA damage-binding protein 1 OS=Homo sapiens GN=DDB1 PE=1 SV=1 2 1147 2.0E-99
sp|Q5R649|DDB1_PONAB DNA damage-binding protein 1 OS=Pongo abelii GN=DDB1 PE=2 SV=1 2 1147 3.0E-99
sp|A1A4K3|DDB1_BOVIN DNA damage-binding protein 1 OS=Bos taurus GN=DDB1 PE=1 SV=1 2 1147 8.0E-99
sp|Q805F9|DDB1_CHICK DNA damage-binding protein 1 OS=Gallus gallus GN=DDB1 PE=1 SV=1 2 1147 9.0E-99
sp|Q9ESW0|DDB1_RAT DNA damage-binding protein 1 OS=Rattus norvegicus GN=Ddb1 PE=1 SV=1 2 1147 2.0E-96
sp|Q6P6Z0|DDB1_XENLA DNA damage-binding protein 1 OS=Xenopus laevis GN=ddb1 PE=2 SV=1 2 1147 6.0E-96
sp|Q9XYZ5|DDB1_DROME DNA damage-binding protein 1 OS=Drosophila melanogaster GN=pic PE=1 SV=1 3 1147 3.0E-86
sp|O13807|DDB1_SCHPO DNA damage-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ddb1 PE=1 SV=1 1 1147 7.0E-83
sp|B0M0P5|DDB1_DICDI DNA damage-binding protein 1 OS=Dictyostelium discoideum GN=repE PE=1 SV=1 2 760 4.0E-52
sp|Q21554|DDB1_CAEEL DNA damage-binding protein 1 OS=Caenorhabditis elegans GN=ddb-1 PE=1 SV=2 1 1147 2.0E-42
sp|B0M0P5|DDB1_DICDI DNA damage-binding protein 1 OS=Dictyostelium discoideum GN=repE PE=1 SV=1 872 1144 8.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0003676 nucleic acid binding Yes
GO:0110165 cellular anatomical entity No
GO:0043229 intracellular organelle No
GO:0003674 molecular_function No
GO:0043226 organelle No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0005575 cellular_component No
GO:0043227 membrane-bounded organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4646
MSYFAPVHRPTSIRHALSIRLLSPDHQDLVVAKTNRLEIWRISDTGMTCLHSKVIFGTIIMLQRLQPKDSPTDLL
FVGTDRQQYFNISWNPQISQLEMVWGPIHDTAEPYMRPSQSQNKCLVDPTGMFMAMHLWEGVINVFRLPTRKGQT
KNIQVLDQVRLTELWMKSSIFLHSRTGHPRIAFLYKTQLGHEEARIAIYRLTRDDKGDDVSRFDSHKDRELDDVI
CDPYASMLIPVPVVEEKRYHVRNNKGARPHLGGVLVVGETVLTYFDSLTYMSVTETLPEPKLYVAWAEYDGICYF
LADDYGCIDLLTIETVHELTGVVITGMSVTRMRLLDPMSHISRASNLVYMGNNLLFLASHHGDSQLLRVNIVEQT
MAVVQTLSNNAPILDFTIMDMGSRQGDSQVTSAFSSGQARIVAGCGAYNDGSLRSIRSGVGLHEDGVLDDIVGTR
GLFALRSPGAAKVDMLVVSSIAETRILRFDANGGIEEVFEFHGMILDQETLLAANLDDGSLLQVTPHSVRVLSMA
GDVEWALLAVEGTTLVSLNLLDNLATASKDAEANSTSGEKDQISCLHAARSPSNLGVVGWWSTGTISIVDLATLE
PLHGESLRKTEDSASIARDIALVQLHPPNTGESTLLVALEDGSVVTFRVTLKEFCISGRKSVTLGSSPARLHILA
QDDGTCNVFATTEHASLIYSSEGRIVFSATSANDATYVVPFDSVAFPKSVLMATDSHLQLCRIDKERLTHVKTLP
LRETVRRVAYSPGLKAFGLGCIKKELVDSEEVITSSFKLVDEVEFQQLGKPVVLDASATLEMVESVIRAQLPDSA
GVPTERFIVGTSFLTDEEIIEDGDMRGRILVLGVDSDRQVYQVLSHKLKGSCRCLGVMGNYIVAGLSKTVVVYSY
SQETTASGSLHKMAAYRTSSYPIDLDIAGNMIGIVDLMQSLCLVEFVPPQEGTEAKLVERGRHHEPTWATSVCHL
DGGRWLEADAQGNLMVLRRNEEAPAERERSRLEVTSDVNIGEQINRIRRLQAVHQENAIVTPKAFLASVEGALYL
FGEISPEYQDLLMTFQERLSACLCLLGDKESGKVRFEEWRAFRGQTRTGEGPYRFIDGEMLERFLDLSETEQKSV
CEGLGPSMEHLRSMVEELRLMH*
Coding >OphauB2|4646
ATGTCTTATTTTGCGCCGGTTCACCGACCTACCAGCATTCGACATGCCCTGAGCATTCGTCTTCTCTCACCAGAC
CACCAAGATCTCGTTGTGGCTAAAACCAACCGACTAGAGATATGGCGCATTTCCGACACTGGCATGACTTGTCTG
CATTCAAAGGTCATCTTTGGAACCATAATCATGCTGCAGCGGCTGCAGCCCAAAGACTCACCCACCGACCTGCTC
TTCGTGGGTACCGATAGGCAGCAATATTTCAACATATCATGGAACCCCCAAATCAGCCAGCTTGAGATGGTTTGG
GGGCCGATTCATGACACTGCCGAGCCATATATGCGTCCTTCTCAGAGCCAAAACAAGTGTCTGGTAGACCCGACA
GGCATGTTCATGGCCATGCATCTTTGGGAAGGCGTCATCAATGTCTTTCGCCTGCCCACCCGCAAGGGCCAGACC
AAGAACATCCAGGTGCTCGACCAAGTTCGACTTACGGAGCTGTGGATGAAATCTAGCATTTTCCTGCATAGTCGA
ACCGGCCACCCACGCATAGCCTTTCTTTACAAGACACAGCTCGGCCACGAAGAGGCGCGCATTGCTATTTACAGA
CTGACAAGAGACGACAAGGGTGATGATGTCTCCCGCTTCGATTCGCACAAGGATAGAGAGCTTGATGATGTTATC
TGCGATCCCTATGCATCGATGCTCATACCAGTCCCCGTGGTCGAAGAGAAGCGTTACCATGTGCGAAACAACAAG
GGAGCCAGGCCTCACCTGGGTGGTGTCCTTGTGGTGGGAGAGACGGTTCTGACCTACTTTGACAGTCTCACTTAT
ATGAGTGTCACTGAGACGCTCCCGGAACCCAAGTTGTACGTGGCCTGGGCTGAATACGACGGCATATGCTACTTC
CTGGCCGATGACTACGGCTGTATAGATCTCTTGACTATAGAAACAGTCCACGAGCTTACAGGCGTTGTAATCACG
GGCATGAGTGTCACTCGAATGCGGCTGCTGGACCCCATGTCGCACATCTCGCGAGCTTCAAATCTTGTGTACATG
GGAAACAATCTTTTGTTCCTGGCCTCACACCACGGCGACTCGCAGCTGCTACGGGTAAACATTGTGGAACAAACA
ATGGCGGTGGTTCAAACGCTGTCAAACAATGCGCCCATTCTCGACTTTACCATCATGGACATGGGAAGCCGTCAA
GGCGACAGCCAAGTCACTAGCGCTTTTTCCTCTGGACAGGCAAGAATTGTGGCGGGCTGTGGCGCCTACAATGAT
GGGAGCTTGCGCAGTATTCGCAGCGGAGTTGGCCTTCACGAAGATGGCGTTCTCGATGACATTGTTGGCACCCGC
GGCCTGTTTGCCCTGCGCTCACCTGGTGCGGCCAAGGTGGACATGCTCGTCGTATCGTCTATAGCTGAGACTAGG
ATTCTCCGCTTTGACGCCAATGGAGGCATAGAAGAAGTTTTCGAATTTCATGGCATGATTTTGGATCAAGAGACG
CTGCTGGCAGCGAATCTTGATGACGGGAGCTTGCTCCAAGTAACGCCACACTCGGTTAGAGTGCTGAGCATGGCC
GGCGACGTGGAGTGGGCTCTGCTGGCCGTGGAGGGAACGACTTTGGTGTCGCTCAACTTGCTCGACAACCTGGCT
ACAGCATCCAAGGATGCAGAGGCAAACTCGACGTCGGGCGAGAAAGACCAGATATCCTGCTTGCATGCAGCAAGA
AGTCCTTCAAATCTGGGCGTGGTGGGCTGGTGGTCTACTGGAACGATATCCATTGTCGACCTGGCCACTCTGGAG
CCACTTCACGGCGAGTCTTTGCGGAAAACAGAGGATAGCGCCTCTATCGCACGAGACATTGCGCTCGTACAGCTC
CATCCACCAAACACAGGCGAATCGACTTTGCTGGTCGCATTGGAGGACGGCAGCGTTGTGACATTTAGGGTGACA
CTCAAAGAGTTTTGTATATCTGGCCGCAAAAGTGTTACCCTGGGCAGCAGCCCTGCCAGGCTACACATCCTGGCT
CAGGACGACGGTACTTGCAATGTCTTTGCCACGACTGAGCATGCTAGCCTGATTTACAGTAGCGAGGGTCGCATT
GTCTTTTCGGCCACTTCTGCAAATGATGCGACGTATGTGGTTCCTTTTGACTCGGTGGCTTTCCCAAAGTCGGTC
TTGATGGCGACAGATTCTCACTTGCAGCTGTGTCGCATCGACAAGGAGCGTCTCACGCACGTCAAGACATTGCCA
CTACGTGAAACAGTGCGCCGCGTTGCTTATTCGCCGGGACTCAAGGCCTTTGGTCTGGGGTGCATAAAGAAGGAA
TTGGTGGACAGTGAGGAAGTAATCACAAGCTCCTTCAAGCTGGTGGATGAAGTTGAATTCCAGCAATTGGGGAAG
CCTGTGGTGCTCGATGCATCGGCCACGCTTGAGATGGTGGAGAGCGTCATACGCGCCCAACTGCCAGATAGCGCT
GGTGTACCTACAGAGCGCTTTATTGTGGGAACCAGCTTCCTGACGGACGAGGAAATTATAGAGGATGGAGACATG
CGCGGCCGCATCTTGGTACTCGGAGTCGACTCTGACCGACAGGTTTATCAAGTGCTTTCCCATAAACTCAAGGGA
TCGTGCCGCTGTTTGGGCGTCATGGGTAACTACATTGTGGCTGGCCTCTCCAAGACGGTTGTCGTTTACAGCTAC
AGCCAAGAGACGACGGCATCCGGATCCTTGCATAAAATGGCGGCATACCGGACGTCATCGTACCCCATTGATTTG
GACATAGCGGGCAACATGATTGGCATCGTTGATCTTATGCAGTCACTTTGTCTCGTCGAGTTTGTCCCTCCACAA
GAGGGTACTGAAGCAAAATTAGTAGAGCGAGGCCGGCATCATGAACCGACTTGGGCGACTTCAGTGTGCCACTTG
GACGGAGGAAGATGGTTAGAGGCCGACGCCCAAGGCAACCTAATGGTTTTGAGGAGAAACGAGGAGGCCCCGGCG
GAGCGAGAACGGTCTCGACTCGAAGTGACGAGTGATGTCAATATTGGAGAGCAAATTAATCGAATACGGAGGCTG
CAAGCAGTCCACCAGGAAAATGCCATTGTGACTCCCAAAGCCTTTCTGGCATCGGTTGAGGGCGCCCTATACCTC
TTTGGAGAGATATCTCCCGAATACCAAGACCTTCTCATGACATTTCAAGAGAGGTTGTCGGCTTGCCTCTGCCTG
CTAGGAGACAAGGAATCGGGAAAAGTGAGGTTTGAAGAGTGGCGAGCCTTTCGCGGCCAGACACGGACCGGCGAG
GGGCCATATAGGTTTATCGACGGAGAAATGCTTGAGAGGTTCTTGGATCTCAGCGAAACGGAGCAGAAGAGCGTG
TGTGAAGGATTAGGACCGAGCATGGAACATCTGCGGAGCATGGTGGAAGAGTTGAGGCTTATGCACTAA
Transcript >OphauB2|4646
ATGTCTTATTTTGCGCCGGTTCACCGACCTACCAGCATTCGACATGCCCTGAGCATTCGTCTTCTCTCACCAGAC
CACCAAGATCTCGTTGTGGCTAAAACCAACCGACTAGAGATATGGCGCATTTCCGACACTGGCATGACTTGTCTG
CATTCAAAGGTCATCTTTGGAACCATAATCATGCTGCAGCGGCTGCAGCCCAAAGACTCACCCACCGACCTGCTC
TTCGTGGGTACCGATAGGCAGCAATATTTCAACATATCATGGAACCCCCAAATCAGCCAGCTTGAGATGGTTTGG
GGGCCGATTCATGACACTGCCGAGCCATATATGCGTCCTTCTCAGAGCCAAAACAAGTGTCTGGTAGACCCGACA
GGCATGTTCATGGCCATGCATCTTTGGGAAGGCGTCATCAATGTCTTTCGCCTGCCCACCCGCAAGGGCCAGACC
AAGAACATCCAGGTGCTCGACCAAGTTCGACTTACGGAGCTGTGGATGAAATCTAGCATTTTCCTGCATAGTCGA
ACCGGCCACCCACGCATAGCCTTTCTTTACAAGACACAGCTCGGCCACGAAGAGGCGCGCATTGCTATTTACAGA
CTGACAAGAGACGACAAGGGTGATGATGTCTCCCGCTTCGATTCGCACAAGGATAGAGAGCTTGATGATGTTATC
TGCGATCCCTATGCATCGATGCTCATACCAGTCCCCGTGGTCGAAGAGAAGCGTTACCATGTGCGAAACAACAAG
GGAGCCAGGCCTCACCTGGGTGGTGTCCTTGTGGTGGGAGAGACGGTTCTGACCTACTTTGACAGTCTCACTTAT
ATGAGTGTCACTGAGACGCTCCCGGAACCCAAGTTGTACGTGGCCTGGGCTGAATACGACGGCATATGCTACTTC
CTGGCCGATGACTACGGCTGTATAGATCTCTTGACTATAGAAACAGTCCACGAGCTTACAGGCGTTGTAATCACG
GGCATGAGTGTCACTCGAATGCGGCTGCTGGACCCCATGTCGCACATCTCGCGAGCTTCAAATCTTGTGTACATG
GGAAACAATCTTTTGTTCCTGGCCTCACACCACGGCGACTCGCAGCTGCTACGGGTAAACATTGTGGAACAAACA
ATGGCGGTGGTTCAAACGCTGTCAAACAATGCGCCCATTCTCGACTTTACCATCATGGACATGGGAAGCCGTCAA
GGCGACAGCCAAGTCACTAGCGCTTTTTCCTCTGGACAGGCAAGAATTGTGGCGGGCTGTGGCGCCTACAATGAT
GGGAGCTTGCGCAGTATTCGCAGCGGAGTTGGCCTTCACGAAGATGGCGTTCTCGATGACATTGTTGGCACCCGC
GGCCTGTTTGCCCTGCGCTCACCTGGTGCGGCCAAGGTGGACATGCTCGTCGTATCGTCTATAGCTGAGACTAGG
ATTCTCCGCTTTGACGCCAATGGAGGCATAGAAGAAGTTTTCGAATTTCATGGCATGATTTTGGATCAAGAGACG
CTGCTGGCAGCGAATCTTGATGACGGGAGCTTGCTCCAAGTAACGCCACACTCGGTTAGAGTGCTGAGCATGGCC
GGCGACGTGGAGTGGGCTCTGCTGGCCGTGGAGGGAACGACTTTGGTGTCGCTCAACTTGCTCGACAACCTGGCT
ACAGCATCCAAGGATGCAGAGGCAAACTCGACGTCGGGCGAGAAAGACCAGATATCCTGCTTGCATGCAGCAAGA
AGTCCTTCAAATCTGGGCGTGGTGGGCTGGTGGTCTACTGGAACGATATCCATTGTCGACCTGGCCACTCTGGAG
CCACTTCACGGCGAGTCTTTGCGGAAAACAGAGGATAGCGCCTCTATCGCACGAGACATTGCGCTCGTACAGCTC
CATCCACCAAACACAGGCGAATCGACTTTGCTGGTCGCATTGGAGGACGGCAGCGTTGTGACATTTAGGGTGACA
CTCAAAGAGTTTTGTATATCTGGCCGCAAAAGTGTTACCCTGGGCAGCAGCCCTGCCAGGCTACACATCCTGGCT
CAGGACGACGGTACTTGCAATGTCTTTGCCACGACTGAGCATGCTAGCCTGATTTACAGTAGCGAGGGTCGCATT
GTCTTTTCGGCCACTTCTGCAAATGATGCGACGTATGTGGTTCCTTTTGACTCGGTGGCTTTCCCAAAGTCGGTC
TTGATGGCGACAGATTCTCACTTGCAGCTGTGTCGCATCGACAAGGAGCGTCTCACGCACGTCAAGACATTGCCA
CTACGTGAAACAGTGCGCCGCGTTGCTTATTCGCCGGGACTCAAGGCCTTTGGTCTGGGGTGCATAAAGAAGGAA
TTGGTGGACAGTGAGGAAGTAATCACAAGCTCCTTCAAGCTGGTGGATGAAGTTGAATTCCAGCAATTGGGGAAG
CCTGTGGTGCTCGATGCATCGGCCACGCTTGAGATGGTGGAGAGCGTCATACGCGCCCAACTGCCAGATAGCGCT
GGTGTACCTACAGAGCGCTTTATTGTGGGAACCAGCTTCCTGACGGACGAGGAAATTATAGAGGATGGAGACATG
CGCGGCCGCATCTTGGTACTCGGAGTCGACTCTGACCGACAGGTTTATCAAGTGCTTTCCCATAAACTCAAGGGA
TCGTGCCGCTGTTTGGGCGTCATGGGTAACTACATTGTGGCTGGCCTCTCCAAGACGGTTGTCGTTTACAGCTAC
AGCCAAGAGACGACGGCATCCGGATCCTTGCATAAAATGGCGGCATACCGGACGTCATCGTACCCCATTGATTTG
GACATAGCGGGCAACATGATTGGCATCGTTGATCTTATGCAGTCACTTTGTCTCGTCGAGTTTGTCCCTCCACAA
GAGGGTACTGAAGCAAAATTAGTAGAGCGAGGCCGGCATCATGAACCGACTTGGGCGACTTCAGTGTGCCACTTG
GACGGAGGAAGATGGTTAGAGGCCGACGCCCAAGGCAACCTAATGGTTTTGAGGAGAAACGAGGAGGCCCCGGCG
GAGCGAGAACGGTCTCGACTCGAAGTGACGAGTGATGTCAATATTGGAGAGCAAATTAATCGAATACGGAGGCTG
CAAGCAGTCCACCAGGAAAATGCCATTGTGACTCCCAAAGCCTTTCTGGCATCGGTTGAGGGCGCCCTATACCTC
TTTGGAGAGATATCTCCCGAATACCAAGACCTTCTCATGACATTTCAAGAGAGGTTGTCGGCTTGCCTCTGCCTG
CTAGGAGACAAGGAATCGGGAAAAGTGAGGTTTGAAGAGTGGCGAGCCTTTCGCGGCCAGACACGGACCGGCGAG
GGGCCATATAGGTTTATCGACGGAGAAATGCTTGAGAGGTTCTTGGATCTCAGCGAAACGGAGCAGAAGAGCGTG
TGTGAAGGATTAGGACCGAGCATGGAACATCTGCGGAGCATGGTGGAAGAGTTGAGGCTTATGCACTAA
Gene >OphauB2|4646
ATGTCTTATTTTGCGCCGGTTCACCGACCTACCAGCATTCGACATGCCCTGAGCATTCGTCTTCTCTCACCAGAC
CACCAAGATCTCGTTGTGGCGTTAGTTGCTTCTGCCTGAGCTCGAGCTAGAGGAACAGCTTTGCTGACTAGAGGC
GCGTACAGTAAAACCAACCGACTAGAGATATGGCGCATTTCCGACACTGGCATGACTTGTCTGCATTCAAAGGTC
ATCTTTGGAACCATAATCATGCTGCAGCGGCTGCAGCCCAAAGACTCACCCACCGACCTGCTCTTCGTGGGTACC
GATAGGCAGCAATATTTCAACATATCATGGAACCCCCAAATCAGCCAGCTTGAGATGGTTTGGGGGCCGATTCAT
GACACTGCCGAGCCATATATGCGTCCTTCTCAGAGCCAAAACAAGTGTCTGGTAGACCCGACAGGCATGTTCATG
GCCATGCATCTTTGGGAAGGCGTCATCAATGTCTTTCGCCTGCCCACCCGCAAGGGCCAGACCAAGAACATCCAG
GTGCTCGACCAAGTTCGACTTACGGAGCTGTGGATGAAATCTAGCATTTTCCTGCATAGTCGAACCGGCCACCCA
CGCATAGCCTTTCTTTACAAGACACAGCTCGGCCACGAAGAGGCGCGCATTGCTATTTACAGACTGACAAGAGAC
GACAAGGGTGATGATGTCTCCCGCTTCGATTCGCACAAGGATAGAGAGCTTGATGATGTTATCTGCGATCCCTAT
GCATCGATGCTCATACCAGTCCCCGTGGTCGAAGAGAAGCGTTACCATGTGCGAAACAACAAGGGAGCCAGGCCT
CACCTGGGTGGTGTCCTTGTGGTGGGAGAGACGGTTCTGACCTACTTTGACAGTCTCACTTATATGAGTGTCACT
GAGACGCTCCCGGAACCCAAGTTGTACGTGGCCTGGGCTGAATACGACGGCATATGCTACTTCCTGGCCGATGAC
TACGGCTGTATAGATCTCTTGACTATAGAAACAGTCCACGAGCTTACAGGCGTTGTAATCACGGGCATGAGTGTC
ACTCGAATGCGGCTGCTGGACCCCATGTCGCACATCTCGCGAGCTTCAAATCTTGTGTACATGGGAAACAATCTT
TTGTTCCTGGCCTCACACCACGGCGACTCGCAGCTGCTACGGGTAAACATTGTGGAACAAACAATGGCGGTGGTT
CAAACGCTGTCAAACAATGCGCCCATTCTCGACTTTACCATCATGGACATGGGAAGCCGTCAAGGCGACAGCCAA
GTCACTAGCGCTTTTTCCTCTGGACAGGCAAGAATTGTGGCGGGCTGTGGCGCCTACAATGATGGGAGCTTGCGC
AGTATTCGCAGCGGAGTTGGCCTTCACGAAGATGGCGTTCTCGATGACATTGTTGGCACCCGCGGCCTGTTTGCC
CTGCGCTCACCTGGTGCGGCCAAGGTGGACATGCTCGTCGTATCGTCTATAGCTGAGACTAGGATTCTCCGCTTT
GACGCCAATGGAGGCATAGAAGAAGTTTTCGAATTTCATGGCATGATTTTGGATCAAGAGACGCTGCTGGCAGCG
AATCTTGATGACGGGAGCTTGCTCCAAGTAACGCCACACTCGGTTAGAGTGCTGAGCATGGCCGGCGACGTGGAG
GTGTGTGCTTGGAAGCCTCCACAAGGAAAAACCATTACGACTGTTTCCTGTAACAGCCAGTGGGCTCTGCTGGCC
GTGGAGGGAACGACTTTGGTGTCGCTCAACTTGCTCGACAACCTGGCTACAGCATCCAAGGATGCAGAGGCAAAC
TCGACGTCGGGCGAGAAAGACCAGATATCCTGCTTGCATGCAGCAAGAAGTCCTTCAAATCTGGGCGTGGTGGGC
TGGTGGTCTACTGGAACGATATCCATTGTCGACCTGGCCACTCTGGAGCCACTTCACGGCGAGTCTTTGCGGAAA
ACAGAGGATAGCGCCTCTATCGCACGAGACATTGCGCTCGTACAGCTCCATCCACCAAACACAGGCGAATCGACT
TTGCTGGTCGCATTGGAGGACGGCAGCGTTGTGACATTTAGGGTGACACTCAAAGAGTTTTGTATATCTGGCCGC
AAAAGTGTTACCCTGGGCAGCAGCCCTGCCAGGCTACACATCCTGGCTCAGGACGACGGTACTTGCAATGTCTTT
GCCACGACTGAGCATGCTAGCCTGATTTACAGTAGCGAGGGTCGCATTGTCTTTTCGGCCACTTCTGCAAATGAT
GCGACGTATGTGGTTCCTTTTGACTCGGTGGCTTTCCCAAAGTCGGTCTTGATGGCGACAGATTCTCACTTGCAG
CTGTGTCGCATCGACAAGGAGCGTCTCACGCACGTCAAGACATTGCCACTACGTGAAACAGTGCGCCGCGTTGCT
TATTCGCCGGGACTCAAGGCCTTTGGTCTGGGGTGCATAAAGAAGGAATTGGTGGACAGTGAGGAAGTAATCACA
AGCTCCTTCAAGCTGGTGGATGAAGTTGAATTCCAGCAATTGGGGAAGCCTGTGGTGCTCGATGCATCGGCCACG
CTTGAGATGGTGGAGAGCGTCATACGCGCCCAACTGCCAGATAGCGCTGGTGTACCTACAGAGCGCTTTATTGTG
GGAACCAGCTTCCTGACGGACGAGGAAATTATAGAGGATGGAGACATGCGCGGCCGCATCTTGGTACTCGGAGTC
GACTCTGACCGACAGGTTTATCAAGTGCTTTCCCATAAACTCAAGGGATCGTGCCGCTGTTTGGGCGTCATGGGT
AACTACATTGTGGCTGGCCTCTCCAAGACGGTTGTCGTTTACAGCTACAGCCAAGAGACGACGGCATCCGGATCC
TTGCATAAAATGGCGGCATACCGGACGTCATCGTACCCCATTGATTTGGACATAGCGGGCAACATGATTGGCATC
GTTGATCTTATGCAGTCACTTTGTCTCGTCGAGTTTGTCCCTCCACAAGAGGGTACTGAAGCAAAATTAGTAGAG
CGAGGCCGGCATCATGAACCGACTTGGGCGACTTCAGTGTGCCACTTGGACGGAGGAAGATGGTTAGAGGCCGAC
GCCCAAGGCAACCTAATGGTTTTGAGGAGAAACGAGGAGGCCCCGGCGGAGCGAGAACGGTCTCGACTCGAAGTG
ACGAGTGATGTCAATATTGGAGAGCAAATTAATCGAATACGGAGGCTGCAAGCAGTCCACCAGGAAAATGCCATT
GTGACTCCCAAAGCCTTTCTGGCATCGGTAAGGGGCATCTCTTGCGCTACAAGGAGCGTGTCGTGCGTGCTGACG
GGAGCTGTCATAGGTTGAGGGCGCCCTATACCTCTTTGGAGAGATATCTCCCGAATACCAAGACCTTCTCATGAC
ATTTCAAGAGAGGTTGTCGGCTTGCCTCTGCCTGCTAGGAGACAAGGAATCGGGAAAAGTGAGGTTTGAAGAGTG
GCGAGCCTTTCGCGGCCAGACACGGACCGGCGAGGGGCCATATAGGTTTATCGACGGAGAAATGCTTGAGAGGTT
CTTGGATCTCAGCGAAACGGAGCAGAAGAGCGTGTGTGAAGGATTAGGACCGAGCATGGAACATCTGCGGAGCAT
GGTGGAAGAGTTGAGGCTTATGCACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail