Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4640
Gene name
LocationContig_31:102871..103790
Strand-
Gene length (bp)919
Transcript length (bp)756
Coding sequence length (bp)756
Protein length (aa) 252

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05916 Sld5 GINS complex protein 5.3E-31 51 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IC11|PSF2_GIBZE DNA replication complex GINS protein PSF2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PSF2 PE=3 SV=1 1 250 1.0E-117
sp|Q7SAA9|PSF2_NEUCR DNA replication complex GINS protein psf2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drc-2 PE=3 SV=1 1 223 5.0E-75
sp|Q5B0M9|PSF2_EMENI DNA replication complex GINS protein psf2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=psf2 PE=3 SV=2 1 243 1.0E-64
sp|Q0UTE1|PSF2_PHANO DNA replication complex GINS protein PSF2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PSF2 PE=3 SV=1 13 248 7.0E-56
sp|Q2UEN6|PSF2_ASPOR DNA replication complex GINS protein psf2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=psf2 PE=3 SV=1 1 232 2.0E-51
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IC11|PSF2_GIBZE DNA replication complex GINS protein PSF2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PSF2 PE=3 SV=1 1 250 1.0E-117
sp|Q7SAA9|PSF2_NEUCR DNA replication complex GINS protein psf2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drc-2 PE=3 SV=1 1 223 5.0E-75
sp|Q5B0M9|PSF2_EMENI DNA replication complex GINS protein psf2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=psf2 PE=3 SV=2 1 243 1.0E-64
sp|Q0UTE1|PSF2_PHANO DNA replication complex GINS protein PSF2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PSF2 PE=3 SV=1 13 248 7.0E-56
sp|Q2UEN6|PSF2_ASPOR DNA replication complex GINS protein psf2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=psf2 PE=3 SV=1 1 232 2.0E-51
sp|Q4X161|PSF2_ASPFU DNA replication complex GINS protein psf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=psf2 PE=3 SV=1 1 246 1.0E-48
sp|Q1DNY1|PSF2_COCIM DNA replication complex GINS protein PSF2 OS=Coccidioides immitis (strain RS) GN=PSF2 PE=3 SV=1 1 250 4.0E-46
sp|Q6BZ44|PSF2_DEBHA DNA replication complex GINS protein PSF2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PSF2 PE=3 SV=2 1 247 2.0E-26
sp|O94329|PSF2_SCHPO DNA replication complex GINS protein psf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psf2 PE=1 SV=1 1 221 2.0E-23
sp|Q6C5R2|PSF2_YARLI DNA replication complex GINS protein PSF2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PSF2 PE=3 SV=1 9 232 3.0E-21
sp|Q9D600|PSF2_MOUSE DNA replication complex GINS protein PSF2 OS=Mus musculus GN=Gins2 PE=1 SV=1 12 226 5.0E-18
sp|Q9C7A8|PSF2_ARATH DNA replication complex GINS protein PSF2 OS=Arabidopsis thaliana GN=GINS2 PE=2 SV=2 11 244 9.0E-18
sp|Q7ZT46|PSF2_XENLA DNA replication complex GINS protein PSF2 OS=Xenopus laevis GN=gins2 PE=1 SV=1 12 221 2.0E-17
sp|P0CQ30|PSF2_CRYNJ DNA replication complex GINS protein PSF2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PSF2 PE=3 SV=1 1 180 4.0E-17
sp|P0CQ31|PSF2_CRYNB DNA replication complex GINS protein PSF2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PSF2 PE=3 SV=1 1 180 4.0E-17
sp|Q54BL9|PSF2_DICDI Probable DNA replication complex GINS protein PSF2 OS=Dictyostelium discoideum GN=gins2 PE=3 SV=1 8 221 6.0E-17
sp|Q9Y248|PSF2_HUMAN DNA replication complex GINS protein PSF2 OS=Homo sapiens GN=GINS2 PE=1 SV=1 12 226 1.0E-16
sp|Q59MA3|PSF2_CANAL DNA replication complex GINS protein PSF2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PSF2 PE=3 SV=1 48 244 1.0E-13
sp|Q8IHI1|PSF2_BRUMA Probable DNA replication complex GINS protein PSF2 OS=Brugia malayi GN=BMBAC01P19.06 PE=3 SV=1 9 208 2.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4640
MAMPMPPGLVPSEVAYLCEMELVTVIPRQRLASINLLTGPTPTLGPPHRSDLPLWLALLLKKQRRANIVPPPWLH
PDSLKEIIHHETVLDRHGWAPPPPPPVRADSRGNATRLASSRPDMPASPPFLPSCTADAPAGALPYHWLEMAEML
LAHAPDDVYAASDVRSLLRDLQEVRSAKMRASTAQLESGLDGVMSLRGVGAMELAEARAFFLGVVEGIRKLGAGA
EATRRDEEENGGNRHDDDELSDQDML*
Coding >OphauB2|4640
ATGGCGATGCCGATGCCGCCAGGCCTGGTGCCCTCAGAGGTGGCCTATCTGTGCGAAATGGAGCTGGTGACTGTA
ATTCCCCGCCAACGGCTTGCCAGCATTAATCTCTTGACTGGCCCAACTCCGACTCTCGGCCCACCACACCGCAGC
GACCTCCCCCTCTGGCTCGCCCTGCTCCTCAAGAAGCAGCGTCGCGCAAACATTGTGCCCCCGCCCTGGCTCCAT
CCCGACTCGCTCAAGGAAATCATTCACCACGAAACCGTGCTCGACCGCCACGGCTGGGCCCCGCCCCCGCCCCCG
CCCGTCCGTGCCGACTCGCGCGGCAACGCGACCCGCCTGGCCTCTTCTCGTCCCGACATGCCCGCCTCGCCTCCA
TTCTTACCCTCGTGTACCGCTGACGCCCCCGCCGGCGCGCTGCCGTACCACTGGCTCGAGATGGCTGAGATGCTG
CTTGCCCATGCGCCCGACGACGTCTATGCTGCGTCGGACGTGCGCTCCCTGCTGCGCGACTTGCAAGAGGTGCGA
TCGGCCAAGATGCGTGCCAGCACGGCACAGCTCGAGTCGGGGCTGGATGGCGTCATGAGTCTTCGTGGTGTGGGA
GCCATGGAGCTGGCCGAGGCGAGGGCTTTTTTCCTGGGCGTTGTAGAAGGTATTCGCAAGCTCGGCGCTGGCGCT
GAAGCGACGCGGCGTGATGAAGAGGAAAATGGTGGTAATCGTCATGACGATGATGAGTTGAGTGATCAAGACATG
TTATGA
Transcript >OphauB2|4640
ATGGCGATGCCGATGCCGCCAGGCCTGGTGCCCTCAGAGGTGGCCTATCTGTGCGAAATGGAGCTGGTGACTGTA
ATTCCCCGCCAACGGCTTGCCAGCATTAATCTCTTGACTGGCCCAACTCCGACTCTCGGCCCACCACACCGCAGC
GACCTCCCCCTCTGGCTCGCCCTGCTCCTCAAGAAGCAGCGTCGCGCAAACATTGTGCCCCCGCCCTGGCTCCAT
CCCGACTCGCTCAAGGAAATCATTCACCACGAAACCGTGCTCGACCGCCACGGCTGGGCCCCGCCCCCGCCCCCG
CCCGTCCGTGCCGACTCGCGCGGCAACGCGACCCGCCTGGCCTCTTCTCGTCCCGACATGCCCGCCTCGCCTCCA
TTCTTACCCTCGTGTACCGCTGACGCCCCCGCCGGCGCGCTGCCGTACCACTGGCTCGAGATGGCTGAGATGCTG
CTTGCCCATGCGCCCGACGACGTCTATGCTGCGTCGGACGTGCGCTCCCTGCTGCGCGACTTGCAAGAGGTGCGA
TCGGCCAAGATGCGTGCCAGCACGGCACAGCTCGAGTCGGGGCTGGATGGCGTCATGAGTCTTCGTGGTGTGGGA
GCCATGGAGCTGGCCGAGGCGAGGGCTTTTTTCCTGGGCGTTGTAGAAGGTATTCGCAAGCTCGGCGCTGGCGCT
GAAGCGACGCGGCGTGATGAAGAGGAAAATGGTGGTAATCGTCATGACGATGATGAGTTGAGTGATCAAGACATG
TTATGA
Gene >OphauB2|4640
ATGGCGATGCCGATGCCGCCAGGCCTGGTGCCCTCAGAGGTGGCCTATCTGTGCGAAATGGAGCTGGTGACTGTA
ATTCCCCGCCAACGGCTTGCCAGCATTAATCTCTTGACTGTAGGACACGACTGCTACTTCTTTCCCCCCTTTTCT
TTTCTTCTTTCTTAATCTCTCTCCATCTTTTTCTTTGTCTTGATGCCTTTTAGTTCCATATTGTATTCACCTCTA
TATATAGACAATTACCTCTGGCGCTTCATCTGCTGACTTGCTCAACCCCCAGGGCCCAACTCCGACTCTCGGCCC
ACCACACCGCAGCGACCTCCCCCTCTGGCTCGCCCTGCTCCTCAAGAAGCAGCGTCGCGCAAACATTGTGCCCCC
GCCCTGGCTCCATCCCGACTCGCTCAAGGAAATCATTCACCACGAAACCGTGCTCGACCGCCACGGCTGGGCCCC
GCCCCCGCCCCCGCCCGTCCGTGCCGACTCGCGCGGCAACGCGACCCGCCTGGCCTCTTCTCGTCCCGACATGCC
CGCCTCGCCTCCATTCTTACCCTCGTGTACCGCTGACGCCCCCGCCGGCGCGCTGCCGTACCACTGGCTCGAGAT
GGCTGAGATGCTGCTTGCCCATGCGCCCGACGACGTCTATGCTGCGTCGGACGTGCGCTCCCTGCTGCGCGACTT
GCAAGAGGTGCGATCGGCCAAGATGCGTGCCAGCACGGCACAGCTCGAGTCGGGGCTGGATGGCGTCATGAGTCT
TCGTGGTGTGGGAGCCATGGAGCTGGCCGAGGCGAGGGCTTTTTTCCTGGGCGTTGTAGAAGGTATTCGCAAGCT
CGGCGCTGGCGCTGAAGCGACGCGGCGTGATGAAGAGGAAAATGGTGGTAATCGTCATGACGATGATGAGTTGAG
TGATCAAGACATGTTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail