Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4638
Gene name
LocationContig_31:97227..98552
Strand-
Gene length (bp)1325
Transcript length (bp)1215
Coding sequence length (bp)1215
Protein length (aa) 405

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04389 Peptidase_M28 Peptidase family M28 3.6E-32 162 367

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7Z6W1|LAP1_NECH7 Leucine aminopeptidase 1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=LAP1 PE=3 SV=1 35 386 4.0E-147
sp|E9F277|LAP1_METRA Leucine aminopeptidase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=LAP1 PE=3 SV=1 1 387 4.0E-144
sp|A4V8W0|LAP1_TRIHA Leucine aminopeptidase 1 OS=Trichoderma harzianum GN=lap1 PE=2 SV=1 1 378 6.0E-142
sp|E9DUF4|LAP1_METAQ Leucine aminopeptidase 1 OS=Metarhizium acridum (strain CQMa 102) GN=LAP1 PE=3 SV=1 1 387 1.0E-140
sp|E3QQU9|LAP1_COLGM Leucine aminopeptidase 1 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=LAP1 PE=3 SV=1 35 388 4.0E-140
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7Z6W1|LAP1_NECH7 Leucine aminopeptidase 1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=LAP1 PE=3 SV=1 35 386 4.0E-147
sp|E9F277|LAP1_METRA Leucine aminopeptidase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=LAP1 PE=3 SV=1 1 387 4.0E-144
sp|A4V8W0|LAP1_TRIHA Leucine aminopeptidase 1 OS=Trichoderma harzianum GN=lap1 PE=2 SV=1 1 378 6.0E-142
sp|E9DUF4|LAP1_METAQ Leucine aminopeptidase 1 OS=Metarhizium acridum (strain CQMa 102) GN=LAP1 PE=3 SV=1 1 387 1.0E-140
sp|E3QQU9|LAP1_COLGM Leucine aminopeptidase 1 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=LAP1 PE=3 SV=1 35 388 4.0E-140
sp|A4R640|LAP1_MAGO7 Leucine aminopeptidase 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=LAP1 PE=3 SV=1 31 388 8.0E-139
sp|Q0U6L1|LAP1_PHANO Leucine aminopeptidase 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=LAP1 PE=3 SV=1 7 378 5.0E-137
sp|F0X8C8|LAP1_GROCL Leucine aminopeptidase 1 OS=Grosmannia clavigera (strain kw1407 / UAMH 11150) GN=LAP1 PE=3 SV=1 28 380 8.0E-137
sp|E4ZHQ5|LAP1_LEPMJ Leucine aminopeptidase 1 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=LAP1 PE=3 SV=1 7 378 3.0E-135
sp|Q2H1T8|LAP1_CHAGB Leucine aminopeptidase 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=LAP1 PE=3 SV=1 23 378 4.0E-135
sp|B2WMR5|LAP1_PYRTR Leucine aminopeptidase 1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=lap1 PE=3 SV=1 35 378 2.0E-134
sp|E3S6P9|LAP1_PYRTT Leucine aminopeptidase 1 OS=Pyrenophora teres f. teres (strain 0-1) GN=lap1 PE=3 SV=1 35 378 2.0E-133
sp|A7ETG2|LAP1_SCLS1 Leucine aminopeptidase 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=lap1 PE=3 SV=1 35 375 6.0E-131
sp|B2B3P6|LAP1_PODAN Leucine aminopeptidase 1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=LAP1 PE=3 SV=1 23 378 2.0E-130
sp|Q7RYC8|LAP1_NEUCR Leucine aminopeptidase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lap1 PE=3 SV=1 23 378 2.0E-128
sp|C5P552|LAP1_COCP7 Leucine aminopeptidase 1 OS=Coccidioides posadasii (strain C735) GN=LAP1 PE=3 SV=1 28 375 2.0E-128
sp|E9DBV9|LAP1_COCPS Leucine aminopeptidase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=LAP1 PE=3 SV=1 28 375 7.0E-128
sp|C4JLL1|LAP1_UNCRE Leucine aminopeptidase 1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=LAP1 PE=3 SV=1 33 375 8.0E-128
sp|C0SJ49|LAP1_PARBP Leucine aminopeptidase 1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=LAP1 PE=3 SV=1 6 375 1.0E-127
sp|C1GMY8|LAP1_PARBD Leucine aminopeptidase 1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=LAP1 PE=3 SV=1 6 375 5.0E-126
sp|C1HC91|LAP1_PARBA Leucine aminopeptidase 1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=LAP1 PE=3 SV=1 13 375 4.0E-122
sp|Q2U1F3|LAPA_ASPOR Leucine aminopeptidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lapA PE=1 SV=1 35 377 6.0E-122
sp|C5GRP9|LAP1_AJEDR Leucine aminopeptidase 1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=LAP1 PE=3 SV=1 32 377 4.0E-121
sp|C6HH71|LAP1_AJECH Leucine aminopeptidase 1 OS=Ajellomyces capsulatus (strain H143) GN=LAP1 PE=3 SV=1 34 378 4.0E-121
sp|F0URV0|LAP1_AJEC8 Leucine aminopeptidase 1 OS=Ajellomyces capsulatus (strain H88) GN=LAP1 PE=3 SV=1 34 378 4.0E-121
sp|A6REE0|LAP1_AJECN Leucine aminopeptidase 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=LAP1 PE=3 SV=1 32 378 6.0E-121
sp|C5JX80|LAP1_AJEDS Leucine aminopeptidase 1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=LAP1 PE=3 SV=1 32 377 6.0E-121
sp|C0NVM2|LAP1_AJECG Leucine aminopeptidase 1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=LAP1 PE=3 SV=1 32 378 7.0E-121
sp|B6H3H1|LAP1_PENRW Leucine aminopeptidase 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lap1 PE=3 SV=1 35 378 1.0E-118
sp|Q8J2N2|LAP1_ASPSO Leucine aminopeptidase 1 OS=Aspergillus sojae GN=lap1 PE=1 SV=1 35 377 1.0E-118
sp|Q2PIT3|LAP1_ASPOR Leucine aminopeptidase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lap1 PE=3 SV=1 9 378 8.0E-117
sp|B8NYX1|LAP1_ASPFN Leucine aminopeptidase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=lap1 PE=3 SV=1 9 378 8.0E-117
sp|A1D9K5|LAP1_NEOFI Leucine aminopeptidase 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=lap1 PE=3 SV=1 35 378 3.0E-115
sp|A1C948|LAP1_ASPCL Leucine aminopeptidase 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=lap1 PE=3 SV=1 35 378 1.0E-114
sp|A2R2G1|LAP1_ASPNC Leucine aminopeptidase 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lap1 PE=3 SV=1 6 378 2.0E-114
sp|Q4W9P4|LAP1_ASPFU Leucine aminopeptidase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lap1 PE=3 SV=2 35 378 3.0E-114
sp|B0YED6|LAP1_ASPFC Leucine aminopeptidase 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lap1 PE=3 SV=2 35 378 3.0E-114
sp|Q5VJG6|LAP1_ASPFM Leucine aminopeptidase 1 OS=Neosartorya fumigata GN=lap1 PE=3 SV=1 35 378 3.0E-114
sp|Q5AXE5|LAP1_EMENI Leucine aminopeptidase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lap1 PE=3 SV=1 35 375 6.0E-114
sp|E4V655|LAP1_ARTGP Leucine aminopeptidase 1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=LAP1 PE=3 SV=1 1 374 6.0E-112
sp|C5FFM0|LAP1_ARTOC Leucine aminopeptidase 1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=LAP1 PE=3 SV=1 35 374 5.0E-111
sp|D4B528|LAP1_ARTBC Probable leucine aminopeptidase 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=LAP1 PE=1 SV=1 1 374 3.0E-110
sp|D4DHE3|LAP1_TRIVH Probable leucine aminopeptidase 1 OS=Trichophyton verrucosum (strain HKI 0517) GN=LAP1 PE=3 SV=1 1 374 9.0E-110
sp|B6V870|LAP1_TRITO Probable leucine aminopeptidase 1 OS=Trichophyton tonsurans GN=LAP1 PE=3 SV=2 1 374 4.0E-109
sp|A7UI11|LAP1_TRIEQ Leucine aminopeptidase 1 OS=Trichophyton equinum GN=LAP1 PE=3 SV=1 1 374 4.0E-109
sp|Q5QHG5|LAP1_TRIRU Leucine aminopeptidase 1 OS=Trichophyton rubrum GN=LAP1 PE=1 SV=1 1 374 1.0E-106
sp|C5FLR8|LAP4_ARTOC Probable leucine aminopeptidase MCYG_03459 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_03459 PE=3 SV=1 1 374 1.0E-95
sp|D4DDS4|LAP4_TRIVH Probable leucine aminopeptidase TRV_05286 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05286 PE=3 SV=1 1 374 3.0E-95
sp|Q04033|YD415_YEAST Probable aminopeptidase YDR415C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR415C PE=3 SV=1 35 374 9.0E-95
sp|D4AZ23|LAP4_ARTBC Probable leucine aminopeptidase ARB_01443 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01443 PE=3 SV=1 1 374 1.0E-94
sp|D4AWL0|LAP5_ARTBC Probable leucine aminopeptidase ARB_00576 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00576 PE=3 SV=1 35 375 2.0E-93
sp|P0CH60|LAP5_TRIVH Probable leucine aminopeptidase TRV_02148.1 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_02148.1 PE=3 SV=1 35 375 1.0E-92
sp|C5FNB5|LAP5_ARTOC Probable leucine aminopeptidase MCYG_04170 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04170 PE=3 SV=1 35 378 2.0E-92
sp|D4DF09|LAP3_TRIVH Probable leucine aminopeptidase TRV_05750 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05750 PE=3 SV=2 35 374 1.0E-91
sp|D4B4V2|LAP3_ARTBC Probable leucine aminopeptidase ARB_03492 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03492 PE=3 SV=1 35 374 2.0E-91
sp|C5G0A8|LAP3_ARTOC Probable leucine aminopeptidase MCYG_08380 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_08380 PE=3 SV=1 35 374 1.0E-90
sp|Q01693|AMPX_VIBPR Bacterial leucyl aminopeptidase OS=Vibrio proteolyticus PE=1 SV=1 92 373 1.0E-44
sp|Q9HZQ8|LAP_PSEAE Aminopeptidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lap PE=1 SV=1 168 266 6.0E-11
sp|Q02PA2|LAP_PSEAB Aminopeptidase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lap PE=1 SV=1 168 266 6.0E-11
sp|P25152|BSAP_BACSU Aminopeptidase YwaD OS=Bacillus subtilis (strain 168) GN=ywaD PE=1 SV=2 172 372 1.0E-10
sp|P37302|APE3_YEAST Aminopeptidase Y OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APE3 PE=1 SV=1 158 264 1.0E-09
sp|D4D3D1|LAP2_TRIVH Probable leucine aminopeptidase 2 OS=Trichophyton verrucosum (strain HKI 0517) GN=LAP2 PE=3 SV=1 138 266 5.0E-09
sp|Q5QHG6|LAP2_TRIRU Leucine aminopeptidase 2 OS=Trichophyton rubrum GN=LAP2 PE=1 SV=1 138 266 7.0E-09
sp|D4AWC9|LAP2_ARTBC Probable leucine aminopeptidase 2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=LAP2 PE=1 SV=1 138 266 8.0E-09
sp|C5FTZ6|LAP2_ARTOC Leucine aminopeptidase 2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=LAP2 PE=3 SV=1 138 266 1.0E-08
sp|A7UI10|LAP2_TRITO Leucine aminopeptidase 2 OS=Trichophyton tonsurans GN=LAP2 PE=3 SV=1 168 266 2.0E-08
sp|A7UI09|LAP2_TRIEQ Leucine aminopeptidase 2 OS=Trichophyton equinum GN=LAP2 PE=3 SV=1 168 266 2.0E-08
sp|E3RJ99|M28P2_PYRTT Probable zinc metalloprotease PTT_08196 OS=Pyrenophora teres f. teres (strain 0-1) GN=PTT_08196 PE=3 SV=1 93 266 2.0E-07
sp|E5R501|M28P3_LEPMJ Probable zinc metalloprotease Lema_P049800 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=Lema_P049800 PE=3 SV=1 93 266 4.0E-07
sp|B2W3C7|M28P2_PYRTR Probable zinc metalloprotease PTRG_04977 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_04977 PE=3 SV=1 93 266 1.0E-06
sp|B2W572|M28P3_PYRTR Probable zinc metalloprotease PTRG_04772 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_04772 PE=3 SV=1 93 266 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4638
MKLLHTALVVAFVPASLALPNSPDGQSQSAAANMLIQLEPDVTMMVNDNDKWQLRKLGKHFMDITKFPGFRFIQS
DEPEPEAVTFPEKCFFQEQVTALLPKLETKTMTRWLDKFSSFHTRFYKSESGRKSSMWLQKEATSIAKGKDRIGV
DNFPHDWTQPSVLAVIPGKTNNTIVVGAHQDSINQMLPTMRSPGADDDGSGTVTLLEVFRVLVKHSALGNNMPLN
TIEFHWYSAEEAGLLGSQEIFYLYSKTGRRVKAMLQQDMTGYVQRTLDAGLPESLGVVTDYVDPGLTAFIKTVID
EYCDIPWVETQCGYACSDHASATKAGYPASFVIESQFNMTNPFIHSAEDTVEHVSYDHMVQHAKMTLGLVYELAY
FDFDRQIESKGKSGGKKPKKPRLGGGPRP*
Coding >OphauB2|4638
ATGAAGCTTTTACACACAGCTCTCGTGGTGGCCTTTGTGCCCGCCAGTTTGGCTCTCCCGAATTCACCTGATGGC
CAGTCCCAGTCTGCGGCTGCCAATATGCTCATCCAACTGGAGCCGGATGTGACCATGATGGTGAATGACAATGAC
AAGTGGCAATTGAGAAAGCTTGGCAAGCACTTTATGGACATTACTAAATTCCCCGGTTTTCGTTTCATTCAATCA
GACGAACCGGAACCCGAGGCCGTCACGTTTCCCGAAAAATGTTTCTTTCAGGAACAAGTCACGGCACTATTGCCC
AAGCTCGAGACCAAGACAATGACGCGCTGGCTTGACAAGTTCTCCAGCTTCCACACTCGTTTCTACAAATCGGAG
TCGGGACGTAAATCAAGCATGTGGCTCCAGAAAGAGGCAACTAGTATTGCAAAGGGCAAGGATAGGATTGGCGTA
GACAACTTCCCACACGACTGGACCCAGCCAAGTGTTTTGGCTGTTATTCCAGGCAAAACAAACAACACGATTGTT
GTAGGCGCGCATCAAGACTCAATTAACCAGATGCTTCCCACCATGAGGTCTCCTGGCGCCGACGACGACGGCAGC
GGCACTGTGACTCTGCTCGAGGTGTTTCGCGTCCTCGTCAAGCACAGTGCGCTGGGCAACAATATGCCGCTCAAC
ACGATTGAATTCCACTGGTACAGCGCCGAGGAGGCTGGTCTTTTGGGCAGCCAGGAAATCTTTTACCTCTACAGC
AAGACTGGCCGCCGAGTCAAGGCGATGCTCCAGCAGGACATGACGGGCTACGTGCAGCGGACGCTCGACGCTGGT
CTCCCAGAGAGCCTGGGAGTCGTGACTGACTATGTCGATCCCGGCCTAACGGCCTTTATCAAGACTGTCATCGAC
GAGTATTGTGACATTCCATGGGTTGAGACGCAATGCGGCTATGCTTGCTCTGACCACGCATCAGCCACAAAGGCG
GGATACCCAGCGTCTTTTGTCATTGAGTCACAGTTCAACATGACGAATCCCTTTATTCACAGCGCTGAAGACACA
GTGGAGCACGTTTCATATGACCACATGGTGCAGCATGCCAAGATGACGCTGGGCCTGGTGTACGAGCTGGCATAC
TTTGACTTTGACAGACAGATCGAATCCAAGGGCAAGTCTGGTGGCAAGAAGCCCAAGAAGCCACGCCTGGGTGGG
GGTCCTAGGCCATAG
Transcript >OphauB2|4638
ATGAAGCTTTTACACACAGCTCTCGTGGTGGCCTTTGTGCCCGCCAGTTTGGCTCTCCCGAATTCACCTGATGGC
CAGTCCCAGTCTGCGGCTGCCAATATGCTCATCCAACTGGAGCCGGATGTGACCATGATGGTGAATGACAATGAC
AAGTGGCAATTGAGAAAGCTTGGCAAGCACTTTATGGACATTACTAAATTCCCCGGTTTTCGTTTCATTCAATCA
GACGAACCGGAACCCGAGGCCGTCACGTTTCCCGAAAAATGTTTCTTTCAGGAACAAGTCACGGCACTATTGCCC
AAGCTCGAGACCAAGACAATGACGCGCTGGCTTGACAAGTTCTCCAGCTTCCACACTCGTTTCTACAAATCGGAG
TCGGGACGTAAATCAAGCATGTGGCTCCAGAAAGAGGCAACTAGTATTGCAAAGGGCAAGGATAGGATTGGCGTA
GACAACTTCCCACACGACTGGACCCAGCCAAGTGTTTTGGCTGTTATTCCAGGCAAAACAAACAACACGATTGTT
GTAGGCGCGCATCAAGACTCAATTAACCAGATGCTTCCCACCATGAGGTCTCCTGGCGCCGACGACGACGGCAGC
GGCACTGTGACTCTGCTCGAGGTGTTTCGCGTCCTCGTCAAGCACAGTGCGCTGGGCAACAATATGCCGCTCAAC
ACGATTGAATTCCACTGGTACAGCGCCGAGGAGGCTGGTCTTTTGGGCAGCCAGGAAATCTTTTACCTCTACAGC
AAGACTGGCCGCCGAGTCAAGGCGATGCTCCAGCAGGACATGACGGGCTACGTGCAGCGGACGCTCGACGCTGGT
CTCCCAGAGAGCCTGGGAGTCGTGACTGACTATGTCGATCCCGGCCTAACGGCCTTTATCAAGACTGTCATCGAC
GAGTATTGTGACATTCCATGGGTTGAGACGCAATGCGGCTATGCTTGCTCTGACCACGCATCAGCCACAAAGGCG
GGATACCCAGCGTCTTTTGTCATTGAGTCACAGTTCAACATGACGAATCCCTTTATTCACAGCGCTGAAGACACA
GTGGAGCACGTTTCATATGACCACATGGTGCAGCATGCCAAGATGACGCTGGGCCTGGTGTACGAGCTGGCATAC
TTTGACTTTGACAGACAGATCGAATCCAAGGGCAAGTCTGGTGGCAAGAAGCCCAAGAAGCCACGCCTGGGTGGG
GGTCCTAGGCCATAG
Gene >OphauB2|4638
ATGAAGCTTTTACACACAGCTCTCGTGGTGGCCTTTGTGCCCGCCAGTTTGGCTCTCCCGAATTCACCTGATGGC
CAGTCCCAGTCTGCGGCTGCCAATATGCTCATCCAACTGGAGCCGGATGTGACCATGATGGTGAATGACAATGAC
AAGTGGCAATTGAGAAAGGTTGGTCATCTTGGCTGGGTCTGCAAACTTGCTGTGACTGACACTATATGGACAGCT
TGGCAAGCACTTTATGGACATTACTAAATTCCCCGGTTTTCGTTTCATTCAATCAGACGAACCGGAACCCGAGGC
CGTCACGTTTCCCGAAAAATGTTTCTTTCAGGAACAAGTCACGGCACTATTGCCCAAGCTCGAGACCAAGACAAT
GACGCGCTGGCTTGACAAGTTCTCCAGCTTCCACACTCGTTTCTACAAATCGGAGTCGGGACGTAAATCAAGCAT
GTGGCTCCAGAAAGAGGCAACTAGTATTGCAAAGGGCAAGGATAGGATTGGCGTAGACAACTTCCCACACGACTG
GACCCAGCCAAGTGTTTTGGCTGTTATTCCAGGCAAAACAAACAACACGATTGTTGTAGGCGCGCATCAAGACTC
AATTAACCAGATGCTTCCCACCATGAGGTCTCCTGGCGCCGACGACGACGGCAGCGGCACTGTGACTCTGCTCGA
GGTGTTTCGCGTCCTCGTCAAGCACAGTGCGCTGGGCAACAATATGCCGCTCAACACGATTGAATTCCACTGGTA
CAGCGCCGAGGAGGCTGGTCTTTTGGGCAGCCAGGAAATCTTTTACCTCTACAGCAAGACTGGCCGCCGAGTCAA
GGCGATGCTCCAGCAGGACATGACGGGCTACGTGCAGCGGACGCTCGACGCTGGTCTCCCAGAGAGCCTGGGAGT
CGTGACTGACTATGTCGATCCCGGCCTAACGGCCTTTATCAAGACTGTCATCGACGAGGTATGTTGCTAGGCCTT
TAACTTCCTTTGAACTGGCGCGCTGACGTGCCTACTAGTATTGTGACATTCCATGGGTTGAGACGCAATGCGGCT
ATGCTTGCTCTGACCACGCATCAGCCACAAAGGCGGGATACCCAGCGTCTTTTGTCATTGAGTCACAGTTCAACA
TGACGAATCCCTTTATTCACAGCGCTGAAGACACAGTGGAGCACGTTTCATATGACCACATGGTGCAGCATGCCA
AGATGACGCTGGGCCTGGTGTACGAGCTGGCATACTTTGACTTTGACAGACAGATCGAATCCAAGGGCAAGTCTG
GTGGCAAGAAGCCCAAGAAGCCACGCCTGGGTGGGGGTCCTAGGCCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail