Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4634
Gene name
LocationContig_31:88256..90491
Strand-
Gene length (bp)2235
Transcript length (bp)2052
Coding sequence length (bp)2052
Protein length (aa) 684

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00520 Ion_trans Ion transport protein 1.3E-07 288 504

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5A2J7|YVC1_CANAL Calcium channel YVC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YVC1 PE=2 SV=1 216 594 2.0E-17
sp|Q12324|YVC1_YEAST Calcium channel YVC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YVC1 PE=1 SV=2 216 601 3.0E-14
sp|Q91YD4|TRPM2_MOUSE Transient receptor potential cation channel subfamily M member 2 OS=Mus musculus GN=Trpm2 PE=2 SV=1 210 441 4.0E-07
sp|O94759|TRPM2_HUMAN Transient receptor potential cation channel subfamily M member 2 OS=Homo sapiens GN=TRPM2 PE=1 SV=2 210 437 4.0E-06
sp|Q7Z2W7|TRPM8_HUMAN Transient receptor potential cation channel subfamily M member 8 OS=Homo sapiens GN=TRPM8 PE=1 SV=2 212 412 6.0E-06

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0006811 ion transport Yes
GO:0005216 ion channel activity Yes
GO:0055085 transmembrane transport Yes
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015267 channel activity No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0022803 passive transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 284 302 18
2 309 328 19
3 343 365 22
4 416 438 22
5 443 465 22
6 472 494 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4634
MPIRLRVGARTARDPSPLSARIEFDLPEIGDDDSFRQVARKLSRYLADAIELPSTFEQLRTTAAGNCLRVLVDHL
NATCTNPSIVHALLALKWHYDADSEHMGLSETRSSACEIVAWRFLVRLSEREAMNFCLYEIPAANNLRQANLGHA
EQGLNTSVSSPLLSRVLPSLENTPEALPLATTPMRARMLKSLARLANNSEESPDGEADPTAAFRGLNALEIAAVA
NAKRFLSQNVVQKIISAIWNGDIVFWDSLSVHSSKRHRFYNPETSDPFSRLRVPKYVKIWEVLFFAVFLCLYYAV
LLVRDEDHINLTEIVLYIWLAAFFYDELSEWMDAGSVFYAADIWNIFDMSMIVIGLIFALLRVIGIANQDKRINN
LAFDVLALEALFMMPRICSILSLSPYWGTLIPCLKEMGKDFLKFMVLVVIIYFGFLTTFSLIGRDTFSFYNMTGI
LTKIFFGSSYVGFEIMNQIDPIFGPPLMIIFITLTSILLTGSMTGMLSNSFSRVIIHAREEYLYIYSVFVLEAST
SNRLTHFYPPFNLLALIIFRPLRLVFPRDEKFRAGRIALLKVTHLPIVATIQLYEVVRRKVHADKYAGLQGPGEA
YVRGPRPPAATPSRPSSSYDRQLWPPPRDSGLIGSRNKGDDDVVDAPTAVEVQIAELNRKIDRLTNVVMSLRDGG
KHTGYDSP*
Coding >OphauB2|4634
ATGCCCATCCGCCTCAGGGTGGGCGCCCGCACAGCGCGCGACCCGAGCCCCTTGAGCGCCCGCATCGAGTTTGAT
CTGCCCGAGATTGGAGATGACGATTCCTTTCGCCAGGTGGCCCGCAAGCTGTCGCGCTACTTGGCCGACGCCATT
GAGCTGCCCAGCACCTTTGAGCAGCTGCGGACCACGGCGGCCGGAAACTGCCTGCGCGTCTTGGTGGACCATCTC
AATGCGACGTGCACGAATCCCTCCATTGTCCATGCCTTGCTCGCGCTCAAGTGGCATTACGATGCCGACTCGGAG
CACATGGGTCTTAGCGAGACTCGCTCAAGCGCCTGCGAGATTGTCGCCTGGCGCTTCCTCGTCCGCCTATCGGAG
CGCGAGGCCATGAATTTTTGCCTCTACGAAATTCCTGCTGCGAATAACCTACGCCAGGCCAACTTGGGCCATGCT
GAGCAAGGCTTGAATACATCAGTCTCTTCACCACTATTGTCTCGCGTCCTACCCAGTCTTGAAAATACTCCAGAG
GCCCTGCCACTAGCTACCACTCCCATGAGGGCCAGGATGCTGAAATCGCTCGCCCGTTTGGCAAACAACTCGGAA
GAATCGCCCGACGGTGAGGCAGATCCCACAGCCGCCTTTAGAGGTCTCAATGCGCTTGAAATTGCGGCAGTGGCC
AACGCCAAGCGCTTCCTCAGCCAAAATGTGGTGCAGAAGATTATAAGTGCCATATGGAACGGGGACATTGTCTTT
TGGGACAGTCTTTCAGTACACTCGTCCAAGAGGCATCGCTTCTACAACCCAGAGACATCGGATCCCTTTTCACGA
CTGCGAGTGCCCAAGTACGTCAAGATTTGGGAGGTACTCTTTTTCGCAGTATTTCTCTGCCTCTACTACGCCGTC
TTGCTCGTCCGTGATGAGGACCACATTAACCTTACCGAAATCGTTCTCTATATTTGGCTCGCGGCCTTCTTTTAC
GATGAGCTGAGCGAGTGGATGGATGCCGGCTCCGTTTTTTATGCAGCAGATATCTGGAATATATTTGACATGAGC
ATGATTGTCATTGGCCTCATATTTGCCCTTTTAAGAGTAATCGGCATCGCTAATCAAGATAAGCGCATAAACAAC
TTGGCATTCGACGTACTTGCCCTCGAAGCCCTCTTCATGATGCCGCGAATTTGTTCCATACTCAGCCTGAGTCCG
TATTGGGGCACGCTTATTCCCTGTCTTAAGGAGATGGGCAAAGACTTTCTCAAGTTCATGGTGCTCGTCGTCATC
ATATACTTTGGCTTCCTCACCACTTTTTCACTTATTGGTCGCGACACGTTTAGCTTCTACAACATGACGGGCATC
CTGACCAAAATCTTTTTTGGTTCGAGCTATGTCGGCTTCGAAATTATGAATCAGATTGACCCCATCTTTGGGCCA
CCGCTAATGATCATCTTCATCACCTTGACATCGATACTTCTTACTGGTTCCATGACTGGTATGCTGTCCAACAGC
TTCTCGCGCGTGATAATTCATGCAAGAGAGGAATACCTCTATATTTACAGCGTGTTTGTGCTTGAGGCATCAACC
AGCAATAGACTCACCCACTTTTATCCGCCCTTTAACCTCTTGGCCCTCATTATATTCCGCCCTCTAAGACTAGTA
TTCCCGCGCGATGAAAAATTTCGCGCCGGTCGCATCGCGTTGCTCAAGGTGACGCATCTGCCAATCGTGGCGACA
ATCCAGCTTTACGAGGTTGTTCGGCGAAAAGTTCACGCCGACAAATATGCCGGCCTGCAAGGCCCGGGAGAGGCG
TATGTTAGAGGCCCGAGGCCACCAGCAGCGACGCCATCGCGGCCTTCGTCAAGCTATGACCGACAGCTGTGGCCG
CCGCCTCGGGACTCGGGCCTGATTGGAAGCCGCAATAAGGGTGACGATGATGTTGTGGATGCGCCTACGGCTGTC
GAGGTACAGATTGCCGAGTTGAATCGCAAGATTGATCGACTCACCAATGTCGTCATGTCACTGCGGGATGGTGGC
AAGCACACTGGGTACGATTCACCGTAG
Transcript >OphauB2|4634
ATGCCCATCCGCCTCAGGGTGGGCGCCCGCACAGCGCGCGACCCGAGCCCCTTGAGCGCCCGCATCGAGTTTGAT
CTGCCCGAGATTGGAGATGACGATTCCTTTCGCCAGGTGGCCCGCAAGCTGTCGCGCTACTTGGCCGACGCCATT
GAGCTGCCCAGCACCTTTGAGCAGCTGCGGACCACGGCGGCCGGAAACTGCCTGCGCGTCTTGGTGGACCATCTC
AATGCGACGTGCACGAATCCCTCCATTGTCCATGCCTTGCTCGCGCTCAAGTGGCATTACGATGCCGACTCGGAG
CACATGGGTCTTAGCGAGACTCGCTCAAGCGCCTGCGAGATTGTCGCCTGGCGCTTCCTCGTCCGCCTATCGGAG
CGCGAGGCCATGAATTTTTGCCTCTACGAAATTCCTGCTGCGAATAACCTACGCCAGGCCAACTTGGGCCATGCT
GAGCAAGGCTTGAATACATCAGTCTCTTCACCACTATTGTCTCGCGTCCTACCCAGTCTTGAAAATACTCCAGAG
GCCCTGCCACTAGCTACCACTCCCATGAGGGCCAGGATGCTGAAATCGCTCGCCCGTTTGGCAAACAACTCGGAA
GAATCGCCCGACGGTGAGGCAGATCCCACAGCCGCCTTTAGAGGTCTCAATGCGCTTGAAATTGCGGCAGTGGCC
AACGCCAAGCGCTTCCTCAGCCAAAATGTGGTGCAGAAGATTATAAGTGCCATATGGAACGGGGACATTGTCTTT
TGGGACAGTCTTTCAGTACACTCGTCCAAGAGGCATCGCTTCTACAACCCAGAGACATCGGATCCCTTTTCACGA
CTGCGAGTGCCCAAGTACGTCAAGATTTGGGAGGTACTCTTTTTCGCAGTATTTCTCTGCCTCTACTACGCCGTC
TTGCTCGTCCGTGATGAGGACCACATTAACCTTACCGAAATCGTTCTCTATATTTGGCTCGCGGCCTTCTTTTAC
GATGAGCTGAGCGAGTGGATGGATGCCGGCTCCGTTTTTTATGCAGCAGATATCTGGAATATATTTGACATGAGC
ATGATTGTCATTGGCCTCATATTTGCCCTTTTAAGAGTAATCGGCATCGCTAATCAAGATAAGCGCATAAACAAC
TTGGCATTCGACGTACTTGCCCTCGAAGCCCTCTTCATGATGCCGCGAATTTGTTCCATACTCAGCCTGAGTCCG
TATTGGGGCACGCTTATTCCCTGTCTTAAGGAGATGGGCAAAGACTTTCTCAAGTTCATGGTGCTCGTCGTCATC
ATATACTTTGGCTTCCTCACCACTTTTTCACTTATTGGTCGCGACACGTTTAGCTTCTACAACATGACGGGCATC
CTGACCAAAATCTTTTTTGGTTCGAGCTATGTCGGCTTCGAAATTATGAATCAGATTGACCCCATCTTTGGGCCA
CCGCTAATGATCATCTTCATCACCTTGACATCGATACTTCTTACTGGTTCCATGACTGGTATGCTGTCCAACAGC
TTCTCGCGCGTGATAATTCATGCAAGAGAGGAATACCTCTATATTTACAGCGTGTTTGTGCTTGAGGCATCAACC
AGCAATAGACTCACCCACTTTTATCCGCCCTTTAACCTCTTGGCCCTCATTATATTCCGCCCTCTAAGACTAGTA
TTCCCGCGCGATGAAAAATTTCGCGCCGGTCGCATCGCGTTGCTCAAGGTGACGCATCTGCCAATCGTGGCGACA
ATCCAGCTTTACGAGGTTGTTCGGCGAAAAGTTCACGCCGACAAATATGCCGGCCTGCAAGGCCCGGGAGAGGCG
TATGTTAGAGGCCCGAGGCCACCAGCAGCGACGCCATCGCGGCCTTCGTCAAGCTATGACCGACAGCTGTGGCCG
CCGCCTCGGGACTCGGGCCTGATTGGAAGCCGCAATAAGGGTGACGATGATGTTGTGGATGCGCCTACGGCTGTC
GAGGTACAGATTGCCGAGTTGAATCGCAAGATTGATCGACTCACCAATGTCGTCATGTCACTGCGGGATGGTGGC
AAGCACACTGGGTACGATTCACCGTAG
Gene >OphauB2|4634
ATGCCCATCCGCCTCAGGGTGGGCGCCCGCACAGCGCGCGACCCGAGCCCCTTGAGCGCCCGCATCGAGTTTGAT
CTGCCCGAGATTGGAGATGACGATTCCTTTCGCCAGGTGGCCCGCAAGCTGTCGCGGTGTGTTGCTTTTGTAGCG
AGGCTTGAGCTGAACCGTGGCTGACCATGTTTGCCGCTGCAGCTACTTGGCCGACGCCATTGAGCTGCCCAGCAC
CTTTGAGCAGCTGCGGACCACGGCGGCCGGAAACTGCCTGCGCGTCTTGGTGGACCATCTCAATGCGACGTGCAC
GAATCCCTCCATTGTCCATGCCTTGCTGTACGTCTGCGATTCCGTCTCTTGCCTCCATCTATGTGCTAAGCGTTG
GTCCATGACCCTCAGCGCGCTCAAGTGGCATTACGATGCCGACTCGGAGCACATGGGTCTTAGCGAGACTCGCTC
AAGCGCCTGCGAGATTGTCGCCTGGCGCTTCCTCGTCCGCCTATCGGAGCGCGAGGCCATGAATTTTTGCCTCTA
CGAAATTCCTGCTGCGAATAACCTACGCCAGGCCAACTTGGGCCATGCTGAGCAAGGCTTGAATACATCAGTCTC
TTCACCACTATTGTCTCGCGTCCTACCCAGTCTTGAAAATACTCCAGAGGCCCTGCCACTAGCTACCACTCCCAT
GAGGGCCAGGATGCTGAAATCGCTCGCCCGTTTGGCAAACAACTCGGAAGAATCGCCCGACGGTGAGGCAGATCC
CACAGCCGCCTTTAGAGGTCTCAATGCGCTTGAAATTGCGGCAGTGGCCAACGCCAAGCGCTTCCTCAGCCAAAA
TGTGGTGCAGAAGATTATAAGTGCCATATGGAACGGGGACATTGTCTTTTGGGACAGTCTTTCAGTACACTCGTC
CAAGAGGCATCGCTTCTACAACCCAGAGACATCGGATCCCTTTTCACGACTGCGAGTGCCCAAGTACGTCAAGAT
TTGGGAGGTACTCTTTTTCGCAGTATTTCTCTGCCTCTACTACGCCGTCTTGCTCGTCCGTGATGAGGACCACAT
TAACCTTACCGAAATCGTTCTCTATATTTGGCTCGCGGCCTTCTTTTACGATGAGCTGAGCGAGTGGATGGATGC
CGGCTCCGTTTTTTATGCAGCAGATATCTGGAATATATTTGACATGAGCATGATTGTCATTGGCCTCATATTTGC
CCTTTTAAGTTTGTTCTTCCACGTCCCTGGTCCAGGTTGCTTTGCTGACGCTGTGCGCCAATGCAAGGAGTAATC
GGCATCGCTAATCAAGATAAGCGCATAAACAACTTGGCATTCGACGTACTTGCCCTCGAAGCCCTCTTCATGATG
CCGCGAATTTGTTCCATACTCAGCCTGAGTCCGTATTGGGGCACGCTTATTCCCTGTCTTAAGGAGATGGGCAAA
GACTTTCTCAAGTTCATGGTGCTCGTCGTCATCATATACTTTGGCTTCCTCACCACTTTTTCACTTATTGGTCGC
GACACGTTTAGCTTCTACAACATGACGGGCATCCTGACCAAAATCTTTTTTGGTTCGAGCTATGTCGGCTTCGAA
ATTATGAATCAGATTGACCCCATCTTTGGGCCACCGCTAATGATCATCTTCATCACCTTGACATCGATACTTCTT
ACTGGTTCCATGACTGGTATGCTGTCCAACAGCTTCTCGCGCGTGATAATTCATGCAAGAGAGGAATACCTCTAT
ATTTACAGCGTGTTTGTGCTTGAGGCATCAACCAGCAATAGACTCACCCACTTTTATCCGCCCTTTAACCTCTTG
GCCCTCATTATATTCCGCCCTCTAAGACTAGTATTCCCGCGCGATGAAAAATTTCGCGCCGGTCGCATCGCGTTG
CTCAAGGTGACGCATCTGCCAATCGTGGCGACAATCCAGCTTTACGAGGTTGTTCGGCGAAAAGTTCACGCCGAC
AAATATGCCGGCCTGCAAGGCCCGGGAGAGGCGTATGTTAGAGGCCCGAGGCCACCAGCAGCGACGCCATCGCGG
CCTTCGTCAAGCTATGACCGACAGCTGTGGCCGCCGCCTCGGGACTCGGGCCTGATTGGAAGCCGCAATAAGGGT
GACGATGATGTTGTGGATGCGCCTACGGCTGTCGAGGTACAGATTGCCGAGTTGAATCGCAAGATTGATCGACTC
ACCAATGTCGTCATGTCACTGCGGGATGGTGGCAAGCACACTGGGTACGATTCACCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail