Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4629
Gene name
LocationContig_31:75828..77391
Strand+
Gene length (bp)1563
Transcript length (bp)1563
Coding sequence length (bp)1563
Protein length (aa) 521

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01180 DHO_dh Dihydroorotate dehydrogenase 8.8E-69 182 516

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CTX8|PYRD2_KLULA Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=URA9 PE=3 SV=1 120 513 3.0E-72
sp|Q874I4|PYRD_CANAL Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=URA9 PE=1 SV=1 109 514 7.0E-72
sp|Q6SZS6|PYRD2_KLUMA Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Kluyveromyces marxianus GN=URA9 PE=3 SV=1 120 514 4.0E-68
sp|Q6SZS5|PYRD_CANGA Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=URA9 PE=3 SV=1 122 514 6.0E-67
sp|Q6V3W9|PYRD_LACK1 Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=URA9 PE=1 SV=1 100 514 2.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CTX8|PYRD2_KLULA Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=URA9 PE=3 SV=1 120 513 3.0E-72
sp|Q874I4|PYRD_CANAL Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=URA9 PE=1 SV=1 109 514 7.0E-72
sp|Q6SZS6|PYRD2_KLUMA Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Kluyveromyces marxianus GN=URA9 PE=3 SV=1 120 514 4.0E-68
sp|Q6SZS5|PYRD_CANGA Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=URA9 PE=3 SV=1 122 514 6.0E-67
sp|Q6V3W9|PYRD_LACK1 Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=URA9 PE=1 SV=1 100 514 2.0E-66
sp|Q75CE1|PYRD_ASHGO Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=URA9 PE=3 SV=1 57 514 9.0E-64
sp|Q02127|PYRD_HUMAN Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Homo sapiens GN=DHODH PE=1 SV=3 102 518 1.0E-60
sp|Q5E9W3|PYRD_BOVIN Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Bos taurus GN=DHODH PE=1 SV=1 97 518 1.0E-59
sp|P32747|PYRD_SCHPO Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ura3 PE=1 SV=1 106 516 1.0E-59
sp|Q5R6X6|PYRD_PONAB Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Pongo abelii GN=DHODH PE=2 SV=1 102 518 2.0E-59
sp|Q63707|PYRD_RAT Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Rattus norvegicus GN=Dhodh PE=1 SV=1 103 518 4.0E-59
sp|O35435|PYRD_MOUSE Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Mus musculus GN=Dhodh PE=1 SV=2 118 518 5.0E-58
sp|Q83CY0|PYRD_COXBU Dihydroorotate dehydrogenase (quinone) OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=pyrD PE=3 SV=1 132 514 2.0E-57
sp|A9NCV1|PYRD_COXBR Dihydroorotate dehydrogenase (quinone) OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=pyrD PE=3 SV=1 132 514 2.0E-57
sp|A9KCF2|PYRD_COXBN Dihydroorotate dehydrogenase (quinone) OS=Coxiella burnetii (strain Dugway 5J108-111) GN=pyrD PE=3 SV=1 132 514 2.0E-57
sp|B6J0A5|PYRD_COXB2 Dihydroorotate dehydrogenase (quinone) OS=Coxiella burnetii (strain CbuG_Q212) GN=pyrD PE=3 SV=1 132 514 2.0E-57
sp|B6J754|PYRD_COXB1 Dihydroorotate dehydrogenase (quinone) OS=Coxiella burnetii (strain CbuK_Q154) GN=pyrD PE=3 SV=1 132 514 2.0E-57
sp|A5EA61|PYRD_BRASB Dihydroorotate dehydrogenase (quinone) OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=pyrD PE=3 SV=1 143 518 3.0E-57
sp|A4Z2G7|PYRD_BRASO Dihydroorotate dehydrogenase (quinone) OS=Bradyrhizobium sp. (strain ORS278) GN=pyrD PE=3 SV=1 143 518 7.0E-57
sp|P32746|PYRD_ARATH Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Arabidopsis thaliana GN=PYRD PE=1 SV=2 121 519 7.0E-57
sp|Q2IR55|PYRD_RHOP2 Dihydroorotate dehydrogenase (quinone) OS=Rhodopseudomonas palustris (strain HaA2) GN=pyrD PE=3 SV=1 140 518 8.0E-57
sp|Q13D13|PYRD_RHOPS Dihydroorotate dehydrogenase (quinone) OS=Rhodopseudomonas palustris (strain BisB5) GN=pyrD PE=3 SV=1 140 518 7.0E-56
sp|B7KZJ5|PYRD_METC4 Dihydroorotate dehydrogenase (quinone) OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=pyrD PE=3 SV=1 147 514 6.0E-54
sp|Q7XKC8|PYRD_ORYSJ Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Oryza sativa subsp. japonica GN=PYRD PE=2 SV=1 121 519 7.0E-54
sp|Q2RX27|PYRD_RHORT Dihydroorotate dehydrogenase (quinone) OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pyrD PE=3 SV=1 147 514 3.0E-53
sp|A7IBC2|PYRD_XANP2 Dihydroorotate dehydrogenase (quinone) OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=pyrD PE=3 SV=1 145 520 5.0E-53
sp|C1CX89|PYRD_DEIDV Dihydroorotate dehydrogenase (quinone) OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=pyrD PE=3 SV=1 138 519 6.0E-53
sp|A0M4D0|PYRD_GRAFK Dihydroorotate dehydrogenase (quinone) OS=Gramella forsetii (strain KT0803) GN=pyrD PE=3 SV=1 132 514 6.0E-53
sp|Q07TQ6|PYRD_RHOP5 Dihydroorotate dehydrogenase (quinone) OS=Rhodopseudomonas palustris (strain BisA53) GN=pyrD PE=3 SV=1 147 518 1.0E-52
sp|A7HQ77|PYRD_PARL1 Dihydroorotate dehydrogenase (quinone) OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=pyrD PE=3 SV=1 147 516 1.0E-52
sp|B3QEE3|PYRD_RHOPT Dihydroorotate dehydrogenase (quinone) OS=Rhodopseudomonas palustris (strain TIE-1) GN=pyrD PE=3 SV=1 143 518 1.0E-52
sp|Q6NBN1|PYRD_RHOPA Dihydroorotate dehydrogenase (quinone) OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=pyrD PE=3 SV=1 143 518 1.0E-52
sp|Q13ZM3|PYRD_BURXL Dihydroorotate dehydrogenase (quinone) OS=Burkholderia xenovorans (strain LB400) GN=pyrD PE=3 SV=2 130 515 1.0E-52
sp|Q609J2|PYRD_METCA Dihydroorotate dehydrogenase (quinone) OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=pyrD PE=3 SV=1 133 516 1.0E-52
sp|A1TZG0|PYRD_MARHV Dihydroorotate dehydrogenase (quinone) OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pyrD PE=3 SV=1 132 518 3.0E-52
sp|A8HZX8|PYRD_AZOC5 Dihydroorotate dehydrogenase (quinone) OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=pyrD PE=3 SV=1 149 520 4.0E-52
sp|Q480K7|PYRD_COLP3 Dihydroorotate dehydrogenase (quinone) OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pyrD PE=3 SV=1 135 510 7.0E-52
sp|B2JKL9|PYRD_BURP8 Dihydroorotate dehydrogenase (quinone) OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=pyrD PE=3 SV=1 130 514 8.0E-52
sp|Q6FCL9|PYRD_ACIAD Dihydroorotate dehydrogenase (quinone) OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pyrD PE=3 SV=1 149 520 1.0E-51
sp|Q1J132|PYRD_DEIGD Dihydroorotate dehydrogenase (quinone) OS=Deinococcus geothermalis (strain DSM 11300) GN=pyrD PE=3 SV=1 133 514 1.0E-51
sp|C1DDY1|PYRD_AZOVD Dihydroorotate dehydrogenase (quinone) OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=pyrD PE=3 SV=1 179 503 2.0E-51
sp|Q8XYY7|PYRD_RALSO Dihydroorotate dehydrogenase (quinone) OS=Ralstonia solanacearum (strain GMI1000) GN=pyrD PE=3 SV=1 132 514 3.0E-51
sp|Q48JY0|PYRD_PSE14 Dihydroorotate dehydrogenase (quinone) OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pyrD PE=3 SV=2 175 503 3.0E-51
sp|Q883P1|PYRD_PSESM Dihydroorotate dehydrogenase (quinone) OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pyrD PE=3 SV=1 177 503 3.0E-51
sp|Q9F1U7|PYRD_FLALU Dihydroorotate dehydrogenase (quinone) OS=Flavobacterium lutescens GN=pyrD PE=3 SV=1 132 515 3.0E-51
sp|Q8P9R0|PYRD_XANCP Dihydroorotate dehydrogenase (quinone) OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pyrD PE=3 SV=1 143 520 4.0E-51
sp|B0RTS3|PYRD_XANCB Dihydroorotate dehydrogenase (quinone) OS=Xanthomonas campestris pv. campestris (strain B100) GN=pyrD PE=3 SV=1 143 520 4.0E-51
sp|Q4UTX5|PYRD_XANC8 Dihydroorotate dehydrogenase (quinone) OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pyrD PE=3 SV=1 143 520 4.0E-51
sp|C3K017|PYRD_PSEFS Dihydroorotate dehydrogenase (quinone) OS=Pseudomonas fluorescens (strain SBW25) GN=pyrD PE=3 SV=1 177 503 6.0E-51
sp|Q11M76|PYRD_CHESB Dihydroorotate dehydrogenase (quinone) OS=Chelativorans sp. (strain BNC1) GN=pyrD PE=3 SV=1 132 520 1.0E-50
sp|B3PIL8|PYRD_CELJU Dihydroorotate dehydrogenase (quinone) OS=Cellvibrio japonicus (strain Ueda107) GN=pyrD PE=3 SV=1 185 503 1.0E-50
sp|Q98B89|PYRD_RHILO Dihydroorotate dehydrogenase (quinone) OS=Rhizobium loti (strain MAFF303099) GN=pyrD PE=3 SV=1 142 503 1.0E-50
sp|A9AJX4|PYRD_BURM1 Dihydroorotate dehydrogenase (quinone) OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=pyrD PE=3 SV=1 147 507 2.0E-50
sp|Q5QX65|PYRD_IDILO Dihydroorotate dehydrogenase (quinone) OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pyrD PE=3 SV=1 132 514 2.0E-50
sp|B1J5B5|PYRD_PSEPW Dihydroorotate dehydrogenase (quinone) OS=Pseudomonas putida (strain W619) GN=pyrD PE=3 SV=1 179 503 2.0E-50
sp|Q88L40|PYRD_PSEPK Dihydroorotate dehydrogenase (quinone) OS=Pseudomonas putida (strain KT2440) GN=pyrD PE=3 SV=1 179 503 3.0E-50
sp|A6VW35|PYRD_MARMS Dihydroorotate dehydrogenase (quinone) OS=Marinomonas sp. (strain MWYL1) GN=pyrD PE=3 SV=1 185 503 3.0E-50
sp|Q8PLJ2|PYRD_XANAC Dihydroorotate dehydrogenase (quinone) OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pyrD PE=3 SV=1 132 520 4.0E-50
sp|P74782|PYRD_SYNY3 Dihydroorotate dehydrogenase (quinone) OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pyrD PE=3 SV=2 136 514 5.0E-50
sp|Q3KFC7|PYRD_PSEPF Dihydroorotate dehydrogenase (quinone) OS=Pseudomonas fluorescens (strain Pf0-1) GN=pyrD PE=3 SV=1 177 503 6.0E-50
sp|Q4ZUM3|PYRD_PSEU2 Dihydroorotate dehydrogenase (quinone) OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pyrD PE=3 SV=1 175 503 6.0E-50
sp|Q1LP27|PYRD_CUPMC Dihydroorotate dehydrogenase (quinone) OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=pyrD PE=3 SV=2 132 515 6.0E-50
sp|A6WVY1|PYRD_OCHA4 Dihydroorotate dehydrogenase (quinone) OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pyrD PE=3 SV=1 142 518 7.0E-50
sp|Q472J6|PYRD_CUPPJ Dihydroorotate dehydrogenase (quinone) OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=pyrD PE=3 SV=1 132 516 7.0E-50
sp|Q0BFR0|PYRD_BURCM Dihydroorotate dehydrogenase (quinone) OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=pyrD PE=3 SV=2 147 507 9.0E-50
sp|Q3BUJ7|PYRD_XANC5 Dihydroorotate dehydrogenase (quinone) OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pyrD PE=3 SV=1 132 520 2.0E-49
sp|B0KG90|PYRD_PSEPG Dihydroorotate dehydrogenase (quinone) OS=Pseudomonas putida (strain GB-1) GN=pyrD PE=3 SV=1 179 503 2.0E-49
sp|Q47RF2|PYRD_THEFY Dihydroorotate dehydrogenase (quinone) OS=Thermobifida fusca (strain YX) GN=pyrD PE=3 SV=1 132 503 2.0E-49
sp|Q4KFI7|PYRD_PSEF5 Dihydroorotate dehydrogenase (quinone) OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=pyrD PE=3 SV=1 177 503 2.0E-49
sp|Q1QBS1|PYRD_PSYCK Dihydroorotate dehydrogenase (quinone) OS=Psychrobacter cryohalolentis (strain K5) GN=pyrD PE=3 SV=1 186 520 2.0E-49
sp|Q1MLT8|PYRD_RHIL3 Dihydroorotate dehydrogenase (quinone) OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=pyrD PE=3 SV=1 143 519 2.0E-49
sp|Q4FS74|PYRD_PSYA2 Dihydroorotate dehydrogenase (quinone) OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=pyrD PE=3 SV=1 186 520 2.0E-49
sp|B2GHT4|PYRD_KOCRD Dihydroorotate dehydrogenase (quinone) OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=pyrD PE=3 SV=1 136 515 4.0E-49
sp|Q9JX66|PYRD_NEIMA Dihydroorotate dehydrogenase (quinone) OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=pyrD PE=3 SV=1 136 516 4.0E-49
sp|A4XWQ0|PYRD_PSEMY Dihydroorotate dehydrogenase (quinone) OS=Pseudomonas mendocina (strain ymp) GN=pyrD PE=3 SV=1 177 503 9.0E-49
sp|Q2SVL9|PYRD_BURTA Dihydroorotate dehydrogenase (quinone) OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=pyrD PE=3 SV=1 147 503 1.0E-48
sp|Q89VA7|PYRD_BRADU Dihydroorotate dehydrogenase (quinone) OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=pyrD PE=3 SV=1 143 518 1.0E-48
sp|A4VM41|PYRD_PSEU5 Dihydroorotate dehydrogenase (quinone) OS=Pseudomonas stutzeri (strain A1501) GN=pyrD PE=3 SV=1 179 503 1.0E-48
sp|Q7VTR9|PYRD_BORPE Dihydroorotate dehydrogenase (quinone) OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=pyrD PE=3 SV=1 143 507 3.0E-48
sp|B2SLB9|PYRD_XANOP Dihydroorotate dehydrogenase (quinone) OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=pyrD PE=3 SV=1 132 520 4.0E-48
sp|A9I8M0|PYRD_BORPD Dihydroorotate dehydrogenase (quinone) OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=pyrD PE=3 SV=1 143 517 5.0E-48
sp|Q5H0N0|PYRD_XANOR Dihydroorotate dehydrogenase (quinone) OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=pyrD PE=3 SV=1 132 520 5.0E-48
sp|Q2P3M0|PYRD_XANOM Dihydroorotate dehydrogenase (quinone) OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=pyrD PE=3 SV=1 132 520 5.0E-48
sp|B5ZPH6|PYRD_RHILW Dihydroorotate dehydrogenase (quinone) OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=pyrD PE=3 SV=1 143 519 5.0E-48
sp|Q21JW9|PYRD_SACD2 Dihydroorotate dehydrogenase (quinone) OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=pyrD PE=3 SV=1 132 503 6.0E-48
sp|B2UNA2|PYRD_AKKM8 Dihydroorotate dehydrogenase (quinone) OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=pyrD PE=3 SV=1 185 516 7.0E-48
sp|B9JR03|PYRD_AGRVS Dihydroorotate dehydrogenase (quinone) OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=pyrD PE=3 SV=1 143 519 1.0E-47
sp|A9IQ81|PYRD_BART1 Dihydroorotate dehydrogenase (quinone) OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=pyrD PE=3 SV=1 143 514 1.0E-47
sp|Q1ICL4|PYRD_PSEE4 Dihydroorotate dehydrogenase (quinone) OS=Pseudomonas entomophila (strain L48) GN=pyrD PE=3 SV=1 179 503 1.0E-47
sp|B9LHC1|PYRD_CHLSY Dihydroorotate dehydrogenase (quinone) OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=pyrD PE=3 SV=1 138 503 2.0E-47
sp|A9WDI1|PYRD_CHLAA Dihydroorotate dehydrogenase (quinone) OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=pyrD PE=3 SV=1 138 503 2.0E-47
sp|B8ID11|PYRD_METNO Dihydroorotate dehydrogenase (quinone) OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=pyrD PE=3 SV=1 147 514 2.0E-47
sp|Q7W4W6|PYRD_BORPA Dihydroorotate dehydrogenase (quinone) OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=pyrD PE=3 SV=1 143 507 2.0E-47
sp|B4E8N4|PYRD_BURCJ Dihydroorotate dehydrogenase (quinone) OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=pyrD PE=3 SV=1 147 509 3.0E-47
sp|A0K729|PYRD_BURCH Dihydroorotate dehydrogenase (quinone) OS=Burkholderia cenocepacia (strain HI2424) GN=pyrD PE=3 SV=2 147 509 3.0E-47
sp|Q1BWM4|PYRD_BURCA Dihydroorotate dehydrogenase (quinone) OS=Burkholderia cenocepacia (strain AU 1054) GN=pyrD PE=3 SV=2 147 509 3.0E-47
sp|Q0A8M5|PYRD_ALKEH Dihydroorotate dehydrogenase (quinone) OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=pyrD PE=3 SV=1 132 503 3.0E-47
sp|A1SJF2|PYRD_NOCSJ Dihydroorotate dehydrogenase (quinone) OS=Nocardioides sp. (strain BAA-499 / JS614) GN=pyrD PE=3 SV=1 143 503 3.0E-47
sp|Q0HVV6|PYRD_SHESR Dihydroorotate dehydrogenase (quinone) OS=Shewanella sp. (strain MR-7) GN=pyrD PE=3 SV=1 147 510 3.0E-47
sp|Q0HJL0|PYRD_SHESM Dihydroorotate dehydrogenase (quinone) OS=Shewanella sp. (strain MR-4) GN=pyrD PE=3 SV=1 147 510 3.0E-47
sp|Q3IU78|PYRD_NATPD Dihydroorotate dehydrogenase (quinone) OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pyrD PE=3 SV=1 132 514 3.0E-47
sp|Q7WGE4|PYRD_BORBR Dihydroorotate dehydrogenase (quinone) OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=pyrD PE=3 SV=1 143 507 4.0E-47
sp|Q2KW44|PYRD_BORA1 Dihydroorotate dehydrogenase (quinone) OS=Bordetella avium (strain 197N) GN=pyrD PE=3 SV=1 143 515 4.0E-47
sp|A0KW50|PYRD_SHESA Dihydroorotate dehydrogenase (quinone) OS=Shewanella sp. (strain ANA-3) GN=pyrD PE=3 SV=1 147 510 5.0E-47
sp|B8H8Q4|PYRD_ARTCA Dihydroorotate dehydrogenase (quinone) OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=pyrD PE=3 SV=1 136 514 5.0E-47
sp|Q8G2K8|PYRD_BRUSU Dihydroorotate dehydrogenase (quinone) OS=Brucella suis biovar 1 (strain 1330) GN=pyrD PE=3 SV=1 143 518 6.0E-47
sp|B0CJU0|PYRD_BRUSI Dihydroorotate dehydrogenase (quinone) OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pyrD PE=3 SV=1 143 518 6.0E-47
sp|A5VNQ1|PYRD_BRUO2 Dihydroorotate dehydrogenase (quinone) OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pyrD PE=3 SV=1 143 518 6.0E-47
sp|A9M7Z9|PYRD_BRUC2 Dihydroorotate dehydrogenase (quinone) OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pyrD PE=3 SV=1 143 518 6.0E-47
sp|Q9PAE7|PYRD_XYLFA Dihydroorotate dehydrogenase (quinone) OS=Xylella fastidiosa (strain 9a5c) GN=pyrD PE=3 SV=2 143 520 7.0E-47
sp|Q57F47|PYRD_BRUAB Dihydroorotate dehydrogenase (quinone) OS=Brucella abortus biovar 1 (strain 9-941) GN=pyrD PE=3 SV=1 143 518 1.0E-46
sp|Q2YPG3|PYRD_BRUA2 Dihydroorotate dehydrogenase (quinone) OS=Brucella abortus (strain 2308) GN=pyrD PE=3 SV=1 143 518 1.0E-46
sp|B2S953|PYRD_BRUA1 Dihydroorotate dehydrogenase (quinone) OS=Brucella abortus (strain S19) GN=pyrD PE=3 SV=1 143 518 1.0E-46
sp|Q9HZF8|PYRD_PSEAE Dihydroorotate dehydrogenase (quinone) OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pyrD PE=3 SV=1 179 503 1.0E-46
sp|B7UWL8|PYRD_PSEA8 Dihydroorotate dehydrogenase (quinone) OS=Pseudomonas aeruginosa (strain LESB58) GN=pyrD PE=3 SV=1 179 503 1.0E-46
sp|Q92S77|PYRD_RHIME Dihydroorotate dehydrogenase (quinone) OS=Rhizobium meliloti (strain 1021) GN=pyrD PE=3 SV=1 143 519 1.0E-46
sp|Q8FTC6|PYRD_COREF Dihydroorotate dehydrogenase (quinone) OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=pyrD PE=3 SV=2 185 520 1.0E-46
sp|Q6G159|PYRD_BARQU Dihydroorotate dehydrogenase (quinone) OS=Bartonella quintana (strain Toulouse) GN=pyrD PE=3 SV=1 143 514 1.0E-46
sp|A7HD76|PYRD_ANADF Dihydroorotate dehydrogenase (quinone) OS=Anaeromyxobacter sp. (strain Fw109-5) GN=pyrD PE=3 SV=1 181 514 1.0E-46
sp|Q8YFB1|PYRD_BRUME Dihydroorotate dehydrogenase (quinone) OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pyrD PE=3 SV=1 143 518 1.0E-46
sp|C0RH28|PYRD_BRUMB Dihydroorotate dehydrogenase (quinone) OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=pyrD PE=3 SV=1 143 518 1.0E-46
sp|Q6NH79|PYRD_CORDI Dihydroorotate dehydrogenase (quinone) OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=pyrD PE=3 SV=1 185 520 2.0E-46
sp|P57858|PYRD_PASMU Dihydroorotate dehydrogenase (quinone) OS=Pasteurella multocida (strain Pm70) GN=pyrD PE=3 SV=1 143 515 2.0E-46
sp|Q1H411|PYRD_METFK Dihydroorotate dehydrogenase (quinone) OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=pyrD PE=3 SV=1 132 514 2.0E-46
sp|Q3JSS8|PYRD_BURP1 Dihydroorotate dehydrogenase (quinone) OS=Burkholderia pseudomallei (strain 1710b) GN=pyrD PE=3 SV=1 147 507 2.0E-46
sp|A1V4A5|PYRD_BURMS Dihydroorotate dehydrogenase (quinone) OS=Burkholderia mallei (strain SAVP1) GN=pyrD PE=3 SV=1 147 507 2.0E-46
sp|Q62K45|PYRD_BURMA Dihydroorotate dehydrogenase (quinone) OS=Burkholderia mallei (strain ATCC 23344) GN=pyrD PE=3 SV=1 147 507 2.0E-46
sp|A2S374|PYRD_BURM9 Dihydroorotate dehydrogenase (quinone) OS=Burkholderia mallei (strain NCTC 10229) GN=pyrD PE=3 SV=1 147 507 2.0E-46
sp|A3MJ98|PYRD_BURM7 Dihydroorotate dehydrogenase (quinone) OS=Burkholderia mallei (strain NCTC 10247) GN=pyrD PE=3 SV=1 147 507 2.0E-46
sp|A3N925|PYRD_BURP6 Dihydroorotate dehydrogenase (quinone) OS=Burkholderia pseudomallei (strain 668) GN=pyrD PE=3 SV=1 147 507 2.0E-46
sp|Q63TV1|PYRD_BURPS Dihydroorotate dehydrogenase (quinone) OS=Burkholderia pseudomallei (strain K96243) GN=pyrD PE=3 SV=1 147 507 2.0E-46
sp|A3NUS1|PYRD_BURP0 Dihydroorotate dehydrogenase (quinone) OS=Burkholderia pseudomallei (strain 1106a) GN=pyrD PE=3 SV=1 147 507 2.0E-46
sp|Q39GX5|PYRD_BURL3 Dihydroorotate dehydrogenase (quinone) OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=pyrD PE=3 SV=2 147 509 2.0E-46
sp|B9J901|PYRD_AGRRK Dihydroorotate dehydrogenase (quinone) OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=pyrD PE=3 SV=1 143 519 3.0E-46
sp|Q02PL5|PYRD_PSEAB Dihydroorotate dehydrogenase (quinone) OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pyrD PE=3 SV=1 179 503 3.0E-46
sp|A6V325|PYRD_PSEA7 Dihydroorotate dehydrogenase (quinone) OS=Pseudomonas aeruginosa (strain PA7) GN=pyrD PE=3 SV=1 179 503 3.0E-46
sp|Q9FB59|PYRD_CORST Dihydroorotate dehydrogenase (quinone) OS=Corynebacterium striatum GN=pyrD PE=3 SV=1 136 520 4.0E-46
sp|Q9RX14|PYRD_DEIRA Dihydroorotate dehydrogenase (quinone) OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pyrD PE=3 SV=1 132 519 5.0E-46
sp|Q15UB7|PYRD_PSEA6 Dihydroorotate dehydrogenase (quinone) OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=pyrD PE=3 SV=1 187 514 5.0E-46
sp|A5UX75|PYRD_ROSS1 Dihydroorotate dehydrogenase (quinone) OS=Roseiflexus sp. (strain RS-1) GN=pyrD PE=3 SV=1 131 514 6.0E-46
sp|A1RJ06|PYRD_SHESW Dihydroorotate dehydrogenase (quinone) OS=Shewanella sp. (strain W3-18-1) GN=pyrD PE=3 SV=1 147 510 8.0E-46
sp|A4Y7I2|PYRD_SHEPC Dihydroorotate dehydrogenase (quinone) OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=pyrD PE=3 SV=1 147 510 8.0E-46
sp|P32748|PYRD_DROME Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Drosophila melanogaster GN=Dhod PE=2 SV=2 181 518 2.0E-45
sp|Q2KCS8|PYRD_RHIEC Dihydroorotate dehydrogenase (quinone) OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=pyrD PE=3 SV=1 143 519 2.0E-45
sp|A5FHT2|PYRD_FLAJ1 Dihydroorotate dehydrogenase (quinone) OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=pyrD PE=3 SV=1 143 514 2.0E-45
sp|B5EL46|PYRD_ACIF5 Dihydroorotate dehydrogenase (quinone) OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=pyrD PE=3 SV=1 140 514 2.0E-45
sp|B7J5Q1|PYRD_ACIF2 Dihydroorotate dehydrogenase (quinone) OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=pyrD PE=3 SV=1 140 514 2.0E-45
sp|Q87PB7|PYRD_VIBPA Dihydroorotate dehydrogenase (quinone) OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pyrD PE=3 SV=1 136 514 2.0E-45
sp|Q12NG2|PYRD_SHEDO Dihydroorotate dehydrogenase (quinone) OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=pyrD PE=3 SV=1 147 515 2.0E-45
sp|Q6G4F7|PYRD_BARHE Dihydroorotate dehydrogenase (quinone) OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=pyrD PE=3 SV=1 143 514 2.0E-45
sp|A9BWU2|PYRD_DELAS Dihydroorotate dehydrogenase (quinone) OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=pyrD PE=3 SV=1 176 507 3.0E-45
sp|A5WDZ3|PYRD_PSYWF Dihydroorotate dehydrogenase (quinone) OS=Psychrobacter sp. (strain PRwf-1) GN=pyrD PE=3 SV=1 186 520 3.0E-45
sp|Q3IGZ1|PYRD_PSEHT Dihydroorotate dehydrogenase (quinone) OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=pyrD PE=3 SV=1 142 514 3.0E-45
sp|Q7NX17|PYRD_CHRVO Dihydroorotate dehydrogenase (quinone) OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pyrD PE=3 SV=1 135 503 4.0E-45
sp|A6T106|PYRD_JANMA Dihydroorotate dehydrogenase (quinone) OS=Janthinobacterium sp. (strain Marseille) GN=pyrD PE=3 SV=1 185 516 4.0E-45
sp|C3LMH4|PYRD_VIBCM Dihydroorotate dehydrogenase (quinone) OS=Vibrio cholerae serotype O1 (strain M66-2) GN=pyrD PE=3 SV=1 136 514 4.0E-45
sp|Q9KRZ2|PYRD_VIBCH Dihydroorotate dehydrogenase (quinone) OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pyrD PE=3 SV=1 136 514 4.0E-45
sp|A5F839|PYRD_VIBC3 Dihydroorotate dehydrogenase (quinone) OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=pyrD PE=3 SV=1 136 514 4.0E-45
sp|Q2Y5H8|PYRD_NITMU Dihydroorotate dehydrogenase (quinone) OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=pyrD PE=3 SV=2 140 514 5.0E-45
sp|Q5F605|PYRD_NEIG1 Dihydroorotate dehydrogenase (quinone) OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=pyrD PE=3 SV=1 136 516 6.0E-45
sp|A6WP30|PYRD_SHEB8 Dihydroorotate dehydrogenase (quinone) OS=Shewanella baltica (strain OS185) GN=pyrD PE=3 SV=1 147 510 6.0E-45
sp|A3D5B9|PYRD_SHEB5 Dihydroorotate dehydrogenase (quinone) OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=pyrD PE=3 SV=1 147 510 6.0E-45
sp|C1ASU1|PYRD_RHOOB Dihydroorotate dehydrogenase (quinone) OS=Rhodococcus opacus (strain B4) GN=pyrD PE=3 SV=1 185 503 6.0E-45
sp|A9L4D0|PYRD_SHEB9 Dihydroorotate dehydrogenase (quinone) OS=Shewanella baltica (strain OS195) GN=pyrD PE=3 SV=1 147 510 7.0E-45
sp|A7N0L2|PYRD_VIBCB Dihydroorotate dehydrogenase (quinone) OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=pyrD PE=3 SV=1 136 514 7.0E-45
sp|Q5E5B6|PYRD_VIBF1 Dihydroorotate dehydrogenase (quinone) OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pyrD PE=3 SV=1 147 514 7.0E-45
sp|A7NLW9|PYRD_ROSCS Dihydroorotate dehydrogenase (quinone) OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=pyrD PE=3 SV=1 132 514 7.0E-45
sp|A0JX31|PYRD_ARTS2 Dihydroorotate dehydrogenase (quinone) OS=Arthrobacter sp. (strain FB24) GN=pyrD PE=3 SV=1 136 514 8.0E-45
sp|A6U5U0|PYRD_SINMW Dihydroorotate dehydrogenase (quinone) OS=Sinorhizobium medicae (strain WSM419) GN=pyrD PE=3 SV=1 143 519 9.0E-45
sp|P28294|PYRD_AGRAE Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Agrocybe aegerita GN=URA1 PE=3 SV=1 142 490 9.0E-45
sp|C5BD71|PYRD_EDWI9 Dihydroorotate dehydrogenase (quinone) OS=Edwardsiella ictaluri (strain 93-146) GN=pyrD PE=3 SV=1 175 514 9.0E-45
sp|C0ZZY4|PYRD_RHOE4 Dihydroorotate dehydrogenase (quinone) OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=pyrD PE=3 SV=1 132 520 9.0E-45
sp|B5FE17|PYRD_VIBFM Dihydroorotate dehydrogenase (quinone) OS=Vibrio fischeri (strain MJ11) GN=pyrD PE=3 SV=1 147 514 1.0E-44
sp|Q3SL21|PYRD_THIDA Dihydroorotate dehydrogenase (quinone) OS=Thiobacillus denitrificans (strain ATCC 25259) GN=pyrD PE=3 SV=1 132 514 1.0E-44
sp|A1K7M2|PYRD_AZOSB Dihydroorotate dehydrogenase (quinone) OS=Azoarcus sp. (strain BH72) GN=pyrD PE=3 SV=1 147 503 1.0E-44
sp|Q5ZUH7|PYRD_LEGPH Dihydroorotate dehydrogenase (quinone) OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=pyrD PE=3 SV=2 132 516 1.0E-44
sp|A5ICX8|PYRD_LEGPC Dihydroorotate dehydrogenase (quinone) OS=Legionella pneumophila (strain Corby) GN=pyrD PE=3 SV=1 132 516 1.0E-44
sp|Q5X496|PYRD_LEGPA Dihydroorotate dehydrogenase (quinone) OS=Legionella pneumophila (strain Paris) GN=pyrD PE=3 SV=1 132 516 1.0E-44
sp|Q0AIB4|PYRD_NITEC Dihydroorotate dehydrogenase (quinone) OS=Nitrosomonas eutropha (strain C91) GN=pyrD PE=3 SV=1 147 514 2.0E-44
sp|Q87A77|PYRD_XYLFT Dihydroorotate dehydrogenase (quinone) OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pyrD PE=3 SV=1 143 516 2.0E-44
sp|B2I9T5|PYRD_XYLF2 Dihydroorotate dehydrogenase (quinone) OS=Xylella fastidiosa (strain M23) GN=pyrD PE=3 SV=1 143 516 2.0E-44
sp|B8E984|PYRD_SHEB2 Dihydroorotate dehydrogenase (quinone) OS=Shewanella baltica (strain OS223) GN=pyrD PE=3 SV=1 147 510 3.0E-44
sp|B3PNN8|PYRD_RHIE6 Dihydroorotate dehydrogenase (quinone) OS=Rhizobium etli (strain CIAT 652) GN=pyrD PE=3 SV=1 143 519 3.0E-44
sp|C4K4A3|PYRD_HAMD5 Dihydroorotate dehydrogenase (quinone) OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=pyrD PE=3 SV=1 150 510 3.0E-44
sp|A4G7T7|PYRD_HERAR Dihydroorotate dehydrogenase (quinone) OS=Herminiimonas arsenicoxydans GN=pyrD PE=3 SV=1 185 516 3.0E-44
sp|A4SME2|PYRD_AERS4 Dihydroorotate dehydrogenase (quinone) OS=Aeromonas salmonicida (strain A449) GN=pyrD PE=3 SV=1 185 510 3.0E-44
sp|Q5P1A9|PYRD_AROAE Dihydroorotate dehydrogenase (quinone) OS=Aromatoleum aromaticum (strain EbN1) GN=pyrD PE=3 SV=1 143 503 4.0E-44
sp|Q1GVC1|PYRD_SPHAL Dihydroorotate dehydrogenase (quinone) OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=pyrD PE=3 SV=1 147 515 5.0E-44
sp|A1URL3|PYRD_BARBK Dihydroorotate dehydrogenase (quinone) OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=pyrD PE=3 SV=1 143 514 5.0E-44
sp|Q113R9|PYRD_TRIEI Dihydroorotate dehydrogenase (quinone) OS=Trichodesmium erythraeum (strain IMS101) GN=pyrD PE=3 SV=1 136 519 6.0E-44
sp|B0U5I1|PYRD_XYLFM Dihydroorotate dehydrogenase (quinone) OS=Xylella fastidiosa (strain M12) GN=pyrD PE=3 SV=1 143 516 6.0E-44
sp|A0KKK9|PYRD_AERHH Dihydroorotate dehydrogenase (quinone) OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=pyrD PE=3 SV=1 185 510 6.0E-44
sp|Q5WVN0|PYRD_LEGPL Dihydroorotate dehydrogenase (quinone) OS=Legionella pneumophila (strain Lens) GN=pyrD PE=3 SV=1 132 516 8.0E-44
sp|A1WTJ3|PYRD_HALHL Dihydroorotate dehydrogenase (quinone) OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=pyrD PE=3 SV=1 185 509 8.0E-44
sp|Q8EDZ8|PYRD_SHEON Dihydroorotate dehydrogenase (quinone) OS=Shewanella oneidensis (strain MR-1) GN=pyrD PE=3 SV=1 147 510 8.0E-44
sp|B4STK4|PYRD_STRM5 Dihydroorotate dehydrogenase (quinone) OS=Stenotrophomonas maltophilia (strain R551-3) GN=pyrD PE=3 SV=1 132 515 9.0E-44
sp|Q2JJF3|PYRD_SYNJB Dihydroorotate dehydrogenase (quinone) OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=pyrD PE=3 SV=1 181 514 1.0E-43
sp|A1JMP8|PYRD_YERE8 Dihydroorotate dehydrogenase (quinone) OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pyrD PE=3 SV=1 186 510 1.0E-43
sp|A1W7S6|PYRD_ACISJ Dihydroorotate dehydrogenase (quinone) OS=Acidovorax sp. (strain JS42) GN=pyrD PE=3 SV=1 178 503 1.0E-43
sp|Q1D7Y6|PYRD_MYXXD Dihydroorotate dehydrogenase (quinone) OS=Myxococcus xanthus (strain DK 1622) GN=pyrD PE=3 SV=1 148 510 1.0E-43
sp|B1JQS0|PYRD_YERPY Dihydroorotate dehydrogenase (quinone) OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=pyrD PE=3 SV=1 147 510 1.0E-43
sp|Q66CG4|PYRD_YERPS Dihydroorotate dehydrogenase (quinone) OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pyrD PE=3 SV=1 147 510 1.0E-43
sp|A4TMZ3|PYRD_YERPP Dihydroorotate dehydrogenase (quinone) OS=Yersinia pestis (strain Pestoides F) GN=pyrD PE=3 SV=1 147 510 1.0E-43
sp|Q1CGJ0|PYRD_YERPN Dihydroorotate dehydrogenase (quinone) OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pyrD PE=3 SV=1 147 510 1.0E-43
sp|A9R7L2|PYRD_YERPG Dihydroorotate dehydrogenase (quinone) OS=Yersinia pestis bv. Antiqua (strain Angola) GN=pyrD PE=3 SV=1 147 510 1.0E-43
sp|Q8ZG91|PYRD_YERPE Dihydroorotate dehydrogenase (quinone) OS=Yersinia pestis GN=pyrD PE=3 SV=1 147 510 1.0E-43
sp|B2JYR8|PYRD_YERPB Dihydroorotate dehydrogenase (quinone) OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=pyrD PE=3 SV=1 147 510 1.0E-43
sp|Q1CA44|PYRD_YERPA Dihydroorotate dehydrogenase (quinone) OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pyrD PE=3 SV=1 147 510 1.0E-43
sp|A7FJU2|PYRD_YERP3 Dihydroorotate dehydrogenase (quinone) OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pyrD PE=3 SV=1 147 510 1.0E-43
sp|C5BKZ2|PYRD_TERTT Dihydroorotate dehydrogenase (quinone) OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=pyrD PE=3 SV=1 185 503 1.0E-43
sp|Q2SCG9|PYRD_HAHCH Dihydroorotate dehydrogenase (quinone) OS=Hahella chejuensis (strain KCTC 2396) GN=pyrD PE=3 SV=1 176 503 2.0E-43
sp|B9MIU2|PYRD_ACIET Dihydroorotate dehydrogenase (quinone) OS=Acidovorax ebreus (strain TPSY) GN=pyrD PE=3 SV=1 178 503 2.0E-43
sp|Q9KXR7|PYRD_STRCO Dihydroorotate dehydrogenase (quinone) OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pyrD PE=3 SV=1 140 503 3.0E-43
sp|B7VNK9|PYRD_VIBTL Dihydroorotate dehydrogenase (quinone) OS=Vibrio tasmaniensis (strain LGP32) GN=pyrD PE=3 SV=1 136 514 4.0E-43
sp|B0VKB8|PYRD_ACIBS Dihydroorotate dehydrogenase (quinone) OS=Acinetobacter baumannii (strain SDF) GN=pyrD PE=3 SV=1 149 520 5.0E-43
sp|Q2N6N6|PYRD_ERYLH Dihydroorotate dehydrogenase (quinone) OS=Erythrobacter litoralis (strain HTCC2594) GN=pyrD PE=3 SV=1 147 514 5.0E-43
sp|A8AID4|PYRD_CITK8 Dihydroorotate dehydrogenase (quinone) OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pyrD PE=3 SV=1 186 510 5.0E-43
sp|Q1B765|PYRD_MYCSS Dihydroorotate dehydrogenase (quinone) OS=Mycobacterium sp. (strain MCS) GN=pyrD PE=3 SV=1 172 503 6.0E-43
sp|A1UHW0|PYRD_MYCSK Dihydroorotate dehydrogenase (quinone) OS=Mycobacterium sp. (strain KMS) GN=pyrD PE=3 SV=1 172 503 6.0E-43
sp|A3Q1C6|PYRD_MYCSJ Dihydroorotate dehydrogenase (quinone) OS=Mycobacterium sp. (strain JLS) GN=pyrD PE=3 SV=1 172 503 6.0E-43
sp|Q6D456|PYRD_PECAS Dihydroorotate dehydrogenase (quinone) OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pyrD PE=3 SV=1 186 510 6.0E-43
sp|Q6LRA2|PYRD_PHOPR Dihydroorotate dehydrogenase (quinone) OS=Photobacterium profundum GN=pyrD PE=3 SV=1 136 510 6.0E-43
sp|B4UG99|PYRD_ANASK Dihydroorotate dehydrogenase (quinone) OS=Anaeromyxobacter sp. (strain K) GN=pyrD PE=3 SV=1 136 514 7.0E-43
sp|B6ELD1|PYRD_ALISL Dihydroorotate dehydrogenase (quinone) OS=Aliivibrio salmonicida (strain LFI1238) GN=pyrD PE=3 SV=1 147 514 7.0E-43
sp|Q08210|PYRD_PLAF7 Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Plasmodium falciparum (isolate 3D7) GN=PFF0160c PE=1 SV=1 173 514 8.0E-43
sp|B8JDF0|PYRD_ANAD2 Dihydroorotate dehydrogenase (quinone) OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=pyrD PE=3 SV=1 136 514 8.0E-43
sp|B2FPI7|PYRD_STRMK Dihydroorotate dehydrogenase (quinone) OS=Stenotrophomonas maltophilia (strain K279a) GN=pyrD PE=3 SV=1 132 515 8.0E-43
sp|Q8NQC0|PYRD_CORGL Dihydroorotate dehydrogenase (quinone) OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pyrD PE=3 SV=1 171 516 8.0E-43
sp|Q8K9I5|PYRD_BUCAP Dihydroorotate dehydrogenase (quinone) OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=pyrD PE=3 SV=1 132 514 1.0E-42
sp|A1VQJ1|PYRD_POLNA Dihydroorotate dehydrogenase (quinone) OS=Polaromonas naphthalenivorans (strain CJ2) GN=pyrD PE=3 SV=1 174 515 1.0E-42
sp|B2VC84|PYRD_ERWT9 Dihydroorotate dehydrogenase (quinone) OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pyrD PE=3 SV=1 147 514 1.0E-42
sp|B1W464|PYRD_STRGG Dihydroorotate dehydrogenase (quinone) OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=pyrD PE=3 SV=1 140 516 1.0E-42
sp|B5XY59|PYRD_KLEP3 Dihydroorotate dehydrogenase (quinone) OS=Klebsiella pneumoniae (strain 342) GN=pyrD PE=3 SV=1 186 510 2.0E-42
sp|B0V824|PYRD_ACIBY Dihydroorotate dehydrogenase (quinone) OS=Acinetobacter baumannii (strain AYE) GN=pyrD PE=3 SV=1 149 520 2.0E-42
sp|A3M6Y2|PYRD_ACIBT Dihydroorotate dehydrogenase (quinone) OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=pyrD PE=3 SV=2 149 520 2.0E-42
sp|B2HUT6|PYRD_ACIBC Dihydroorotate dehydrogenase (quinone) OS=Acinetobacter baumannii (strain ACICU) GN=pyrD PE=3 SV=1 149 520 2.0E-42
sp|B7I2L5|PYRD_ACIB5 Dihydroorotate dehydrogenase (quinone) OS=Acinetobacter baumannii (strain AB0057) GN=pyrD PE=3 SV=1 149 520 2.0E-42
sp|B7GZW7|PYRD_ACIB3 Dihydroorotate dehydrogenase (quinone) OS=Acinetobacter baumannii (strain AB307-0294) GN=pyrD PE=3 SV=1 149 520 2.0E-42
sp|A6T739|PYRD_KLEP7 Dihydroorotate dehydrogenase (quinone) OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=pyrD PE=3 SV=1 186 510 2.0E-42
sp|Q081J9|PYRD_SHEFN Dihydroorotate dehydrogenase (quinone) OS=Shewanella frigidimarina (strain NCIMB 400) GN=pyrD PE=3 SV=1 147 510 2.0E-42
sp|A1TPZ2|PYRD_ACIAC Dihydroorotate dehydrogenase (quinone) OS=Acidovorax citrulli (strain AAC00-1) GN=pyrD PE=3 SV=1 187 516 3.0E-42
sp|C3MFT0|PYRD_RHISN Dihydroorotate dehydrogenase (quinone) OS=Rhizobium sp. (strain NGR234) GN=pyrD PE=3 SV=1 143 519 3.0E-42
sp|A3QDX8|PYRD_SHELP Dihydroorotate dehydrogenase (quinone) OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=pyrD PE=3 SV=1 147 510 3.0E-42
sp|Q5YVM8|PYRD_NOCFA Dihydroorotate dehydrogenase (quinone) OS=Nocardia farcinica (strain IFM 10152) GN=pyrD PE=3 SV=1 140 514 4.0E-42
sp|B7LNV5|PYRD_ESCF3 Dihydroorotate dehydrogenase (quinone) OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pyrD PE=3 SV=1 186 510 4.0E-42
sp|A1WJ81|PYRD_VEREI Dihydroorotate dehydrogenase (quinone) OS=Verminephrobacter eiseniae (strain EF01-2) GN=pyrD PE=3 SV=1 187 516 4.0E-42
sp|A8GCK4|PYRD_SERP5 Dihydroorotate dehydrogenase (quinone) OS=Serratia proteamaculans (strain 568) GN=pyrD PE=3 SV=1 186 510 5.0E-42
sp|P45477|PYRD_HAEIN Dihydroorotate dehydrogenase (quinone) OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pyrD PE=3 SV=1 132 515 6.0E-42
sp|Q82ST3|PYRD_NITEU Dihydroorotate dehydrogenase (quinone) OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=pyrD PE=3 SV=1 147 508 6.0E-42
sp|Q0KBT4|PYRD_CUPNH Dihydroorotate dehydrogenase (quinone) OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=pyrD PE=3 SV=1 143 515 7.0E-42
sp|A9CK85|PYRD_AGRFC Dihydroorotate dehydrogenase (quinone) OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=pyrD PE=3 SV=1 143 518 8.0E-42
sp|B4EVC3|PYRD_PROMH Dihydroorotate dehydrogenase (quinone) OS=Proteus mirabilis (strain HI4320) GN=pyrD PE=3 SV=1 132 514 8.0E-42
sp|Q9HMK2|PYRD_HALSA Dihydroorotate dehydrogenase (quinone) OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pyrD PE=3 SV=1 149 519 1.0E-41
sp|B0R808|PYRD_HALS3 Dihydroorotate dehydrogenase (quinone) OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pyrD PE=3 SV=1 149 519 1.0E-41
sp|Q32HW1|PYRD_SHIDS Dihydroorotate dehydrogenase (quinone) OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pyrD PE=3 SV=1 183 510 1.0E-41
sp|P25468|PYRD_SALTY Dihydroorotate dehydrogenase (quinone) OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pyrD PE=3 SV=2 186 510 1.0E-41
sp|B4TRW8|PYRD_SALSV Dihydroorotate dehydrogenase (quinone) OS=Salmonella schwarzengrund (strain CVM19633) GN=pyrD PE=3 SV=1 186 510 1.0E-41
sp|B5BBM2|PYRD_SALPK Dihydroorotate dehydrogenase (quinone) OS=Salmonella paratyphi A (strain AKU_12601) GN=pyrD PE=3 SV=1 186 510 1.0E-41
sp|C0PVS5|PYRD_SALPC Dihydroorotate dehydrogenase (quinone) OS=Salmonella paratyphi C (strain RKS4594) GN=pyrD PE=3 SV=1 186 510 1.0E-41
sp|A9N6Y4|PYRD_SALPB Dihydroorotate dehydrogenase (quinone) OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pyrD PE=3 SV=1 186 510 1.0E-41
sp|Q5PGE0|PYRD_SALPA Dihydroorotate dehydrogenase (quinone) OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pyrD PE=3 SV=1 186 510 1.0E-41
sp|B4T1Y8|PYRD_SALNS Dihydroorotate dehydrogenase (quinone) OS=Salmonella newport (strain SL254) GN=pyrD PE=3 SV=1 186 510 1.0E-41
sp|B4TDY5|PYRD_SALHS Dihydroorotate dehydrogenase (quinone) OS=Salmonella heidelberg (strain SL476) GN=pyrD PE=3 SV=1 186 510 1.0E-41
sp|B5QZE8|PYRD_SALEP Dihydroorotate dehydrogenase (quinone) OS=Salmonella enteritidis PT4 (strain P125109) GN=pyrD PE=3 SV=1 186 510 1.0E-41
sp|B5FQY8|PYRD_SALDC Dihydroorotate dehydrogenase (quinone) OS=Salmonella dublin (strain CT_02021853) GN=pyrD PE=3 SV=1 186 510 1.0E-41
sp|B5F1U2|PYRD_SALA4 Dihydroorotate dehydrogenase (quinone) OS=Salmonella agona (strain SL483) GN=pyrD PE=3 SV=1 186 510 1.0E-41
sp|Q83RX6|PYRD_SHIFL Dihydroorotate dehydrogenase (quinone) OS=Shigella flexneri GN=pyrD PE=3 SV=4 183 510 1.0E-41
sp|Q0T689|PYRD_SHIF8 Dihydroorotate dehydrogenase (quinone) OS=Shigella flexneri serotype 5b (strain 8401) GN=pyrD PE=3 SV=1 183 510 1.0E-41
sp|B5R8M3|PYRD_SALG2 Dihydroorotate dehydrogenase (quinone) OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pyrD PE=3 SV=1 186 510 1.0E-41
sp|B2HFZ1|PYRD_MYCMM Dihydroorotate dehydrogenase (quinone) OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pyrD PE=3 SV=1 181 504 1.0E-41
sp|B1LJR7|PYRD_ECOSM Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pyrD PE=3 SV=1 183 510 1.0E-41
sp|B7N3A7|PYRD_ECOLU Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pyrD PE=3 SV=1 183 510 1.0E-41
sp|B7NM29|PYRD_ECO7I Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pyrD PE=3 SV=1 183 510 1.0E-41
sp|A4QEA4|PYRD_CORGB Dihydroorotate dehydrogenase (quinone) OS=Corynebacterium glutamicum (strain R) GN=pyrD PE=3 SV=1 171 516 2.0E-41
sp|Q1RDR9|PYRD_ECOUT Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli (strain UTI89 / UPEC) GN=pyrD PE=3 SV=2 183 510 2.0E-41
sp|Q8FJ91|PYRD_ECOL6 Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pyrD PE=3 SV=2 183 510 2.0E-41
sp|Q0TJB6|PYRD_ECOL5 Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pyrD PE=3 SV=1 183 510 2.0E-41
sp|A1A9L5|PYRD_ECOK1 Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli O1:K1 / APEC GN=pyrD PE=3 SV=1 183 510 2.0E-41
sp|B7MS56|PYRD_ECO81 Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli O81 (strain ED1a) GN=pyrD PE=3 SV=1 183 510 2.0E-41
sp|B7MHP7|PYRD_ECO45 Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pyrD PE=3 SV=1 183 510 2.0E-41
sp|B7UN24|PYRD_ECO27 Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pyrD PE=3 SV=1 183 510 2.0E-41
sp|A5UEP8|PYRD_HAEIG Dihydroorotate dehydrogenase (quinone) OS=Haemophilus influenzae (strain PittGG) GN=pyrD PE=3 SV=1 132 515 2.0E-41
sp|A1TAT2|PYRD_MYCVP Dihydroorotate dehydrogenase (quinone) OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=pyrD PE=3 SV=1 181 516 2.0E-41
sp|A6H0L5|PYRD_FLAPJ Dihydroorotate dehydrogenase (quinone) OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=pyrD PE=3 SV=1 156 514 2.0E-41
sp|Q9K1D7|PYRD_NEIMB Dihydroorotate dehydrogenase (quinone) OS=Neisseria meningitidis serogroup B (strain MC58) GN=pyrD PE=3 SV=1 136 516 2.0E-41
sp|B1KDM8|PYRD_SHEWM Dihydroorotate dehydrogenase (quinone) OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=pyrD PE=3 SV=1 147 517 3.0E-41
sp|A2SHQ5|PYRD_METPP Dihydroorotate dehydrogenase (quinone) OS=Methylibium petroleiphilum (strain PM1) GN=pyrD PE=3 SV=1 136 515 3.0E-41
sp|A5EV79|PYRD_DICNV Dihydroorotate dehydrogenase (quinone) OS=Dichelobacter nodosus (strain VCS1703A) GN=pyrD PE=3 SV=1 185 518 3.0E-41
sp|B3R4T0|PYRD_CUPTR Dihydroorotate dehydrogenase (quinone) OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=pyrD PE=3 SV=1 143 515 3.0E-41
sp|Q7MKX3|PYRD_VIBVY Dihydroorotate dehydrogenase (quinone) OS=Vibrio vulnificus (strain YJ016) GN=pyrD PE=3 SV=1 136 514 3.0E-41
sp|A9MHU3|PYRD_SALAR Dihydroorotate dehydrogenase (quinone) OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=pyrD PE=3 SV=1 186 510 3.0E-41
sp|A5UC11|PYRD_HAEIE Dihydroorotate dehydrogenase (quinone) OS=Haemophilus influenzae (strain PittEE) GN=pyrD PE=3 SV=1 132 515 4.0E-41
sp|A1SX25|PYRD_PSYIN Dihydroorotate dehydrogenase (quinone) OS=Psychromonas ingrahamii (strain 37) GN=pyrD PE=3 SV=1 185 510 4.0E-41
sp|Q4QKB5|PYRD_HAEI8 Dihydroorotate dehydrogenase (quinone) OS=Haemophilus influenzae (strain 86-028NP) GN=pyrD PE=3 SV=1 132 515 4.0E-41
sp|A8H3X8|PYRD_SHEPA Dihydroorotate dehydrogenase (quinone) OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=pyrD PE=3 SV=1 142 510 4.0E-41
sp|Q8Z7S9|PYRD_SALTI Dihydroorotate dehydrogenase (quinone) OS=Salmonella typhi GN=pyrD PE=3 SV=1 186 510 5.0E-41
sp|Q21WC4|PYRD_RHOFT Dihydroorotate dehydrogenase (quinone) OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=pyrD PE=3 SV=1 187 503 5.0E-41
sp|Q3Z3H6|PYRD_SHISS Dihydroorotate dehydrogenase (quinone) OS=Shigella sonnei (strain Ss046) GN=pyrD PE=3 SV=1 183 510 5.0E-41
sp|Q31YK8|PYRD_SHIBS Dihydroorotate dehydrogenase (quinone) OS=Shigella boydii serotype 4 (strain Sb227) GN=pyrD PE=3 SV=1 183 510 5.0E-41
sp|B2TUD4|PYRD_SHIB3 Dihydroorotate dehydrogenase (quinone) OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pyrD PE=3 SV=1 183 510 5.0E-41
sp|B6I919|PYRD_ECOSE Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli (strain SE11) GN=pyrD PE=3 SV=1 183 510 5.0E-41
sp|P0A7E1|PYRD_ECOLI Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli (strain K12) GN=pyrD PE=1 SV=1 183 510 5.0E-41
sp|B1IVY7|PYRD_ECOLC Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pyrD PE=3 SV=1 183 510 5.0E-41
sp|A7ZYP7|PYRD_ECOHS Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli O9:H4 (strain HS) GN=pyrD PE=3 SV=1 183 510 5.0E-41
sp|B1X8P9|PYRD_ECODH Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli (strain K12 / DH10B) GN=pyrD PE=3 SV=1 183 510 5.0E-41
sp|C4ZQ71|PYRD_ECOBW Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pyrD PE=3 SV=1 183 510 5.0E-41
sp|B7M874|PYRD_ECO8A Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli O8 (strain IAI1) GN=pyrD PE=3 SV=1 183 510 5.0E-41
sp|B5YT76|PYRD_ECO5E Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pyrD PE=3 SV=1 183 510 5.0E-41
sp|P0A7E2|PYRD_ECO57 Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli O157:H7 GN=pyrD PE=3 SV=1 183 510 5.0E-41
sp|B7LE45|PYRD_ECO55 Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli (strain 55989 / EAEC) GN=pyrD PE=3 SV=1 183 510 5.0E-41
sp|A7ZK49|PYRD_ECO24 Dihydroorotate dehydrogenase (quinone) OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pyrD PE=3 SV=1 183 510 5.0E-41
sp|B9KNA2|PYRD_RHOSK Dihydroorotate dehydrogenase (quinone) OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=pyrD PE=3 SV=1 147 518 5.0E-41
sp|C6DFC0|PYRD_PECCP Dihydroorotate dehydrogenase (quinone) OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pyrD PE=3 SV=1 186 510 7.0E-41
sp|A9M3G1|PYRD_NEIM0 Dihydroorotate dehydrogenase (quinone) OS=Neisseria meningitidis serogroup C (strain 053442) GN=pyrD PE=3 SV=1 136 516 7.0E-41
sp|A1KRQ4|PYRD_NEIMF Dihydroorotate dehydrogenase (quinone) OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=pyrD PE=3 SV=1 136 516 7.0E-41
sp|B0TIY0|PYRD_SHEHH Dihydroorotate dehydrogenase (quinone) OS=Shewanella halifaxensis (strain HAW-EB4) GN=pyrD PE=3 SV=1 142 510 8.0E-41
sp|Q65TR8|PYRD_MANSM Dihydroorotate dehydrogenase (quinone) OS=Mannheimia succiniciproducens (strain MBEL55E) GN=pyrD PE=3 SV=1 185 515 1.0E-40
sp|A7MEW0|PYRD_CROS8 Dihydroorotate dehydrogenase (quinone) OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pyrD PE=3 SV=1 186 514 1.0E-40
sp|Q8D9G5|PYRD_VIBVU Dihydroorotate dehydrogenase (quinone) OS=Vibrio vulnificus (strain CMCP6) GN=pyrD PE=3 SV=1 136 514 1.0E-40
sp|A6Q2V6|PYRD_NITSB Dihydroorotate dehydrogenase (quinone) OS=Nitratiruptor sp. (strain SB155-2) GN=pyrD PE=3 SV=1 143 514 1.0E-40
sp|A3PN03|PYRD_RHOS1 Dihydroorotate dehydrogenase (quinone) OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=pyrD PE=3 SV=1 147 518 1.0E-40
sp|A4TB97|PYRD_MYCGI Dihydroorotate dehydrogenase (quinone) OS=Mycobacterium gilvum (strain PYR-GCK) GN=pyrD PE=3 SV=1 181 516 2.0E-40
sp|A0PQW5|PYRD_MYCUA Dihydroorotate dehydrogenase (quinone) OS=Mycobacterium ulcerans (strain Agy99) GN=pyrD PE=3 SV=1 181 504 3.0E-40
sp|P46727|PYRD_MYCLE Dihydroorotate dehydrogenase (quinone) OS=Mycobacterium leprae (strain TN) GN=pyrD PE=3 SV=3 181 503 3.0E-40
sp|Q3IZ94|PYRD_RHOS4 Dihydroorotate dehydrogenase (quinone) OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=pyrD PE=3 SV=1 147 518 3.0E-40
sp|Q7N617|PYRD_PHOLL Dihydroorotate dehydrogenase (quinone) OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pyrD PE=3 SV=1 150 514 3.0E-40
sp|Q57QU4|PYRD_SALCH Dihydroorotate dehydrogenase (quinone) OS=Salmonella choleraesuis (strain SC-B67) GN=pyrD PE=3 SV=1 186 510 3.0E-40
sp|B8HW33|PYRD_CYAP4 Dihydroorotate dehydrogenase (quinone) OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=pyrD PE=3 SV=1 175 510 3.0E-40
sp|Q73YS2|PYRD_MYCPA Dihydroorotate dehydrogenase (quinone) OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=pyrD PE=3 SV=1 181 504 3.0E-40
sp|B7KIU7|PYRD_CYAP7 Dihydroorotate dehydrogenase (quinone) OS=Cyanothece sp. (strain PCC 7424) GN=pyrD PE=3 SV=1 181 519 5.0E-40
sp|Q129L9|PYRD_POLSJ Dihydroorotate dehydrogenase (quinone) OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=pyrD PE=3 SV=1 174 503 5.0E-40
sp|B1XV77|PYRD_POLNS Dihydroorotate dehydrogenase (quinone) OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=pyrD PE=3 SV=1 140 515 6.0E-40
sp|A4SWU5|PYRD_POLSQ Dihydroorotate dehydrogenase (quinone) OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=pyrD PE=3 SV=1 140 515 9.0E-40
sp|Q7NC99|PYRD_GLOVI Dihydroorotate dehydrogenase (quinone) OS=Gloeobacter violaceus (strain PCC 7421) GN=pyrD PE=3 SV=1 138 514 1.0E-39
sp|A6VP48|PYRD_ACTSZ Dihydroorotate dehydrogenase (quinone) OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=pyrD PE=3 SV=1 185 515 1.0E-39
sp|Q2IQI6|PYRD_ANADE Dihydroorotate dehydrogenase (quinone) OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=pyrD PE=3 SV=1 181 514 1.0E-39
sp|A1S5Z4|PYRD_SHEAM Dihydroorotate dehydrogenase (quinone) OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=pyrD PE=3 SV=1 147 510 1.0E-39
sp|Q47GW1|PYRD_DECAR Dihydroorotate dehydrogenase (quinone) OS=Dechloromonas aromatica (strain RCB) GN=pyrD PE=3 SV=1 135 514 3.0E-39
sp|A0QZY9|PYRD_MYCS2 Dihydroorotate dehydrogenase (quinone) OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pyrD PE=3 SV=1 181 517 3.0E-39
sp|A6WD43|PYRD_KINRD Dihydroorotate dehydrogenase (quinone) OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=pyrD PE=3 SV=1 143 517 4.0E-39
sp|B1MPD4|PYRD_MYCA9 Dihydroorotate dehydrogenase (quinone) OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=pyrD PE=3 SV=1 140 503 4.0E-39
sp|B7JXU8|PYRD_CYAP8 Dihydroorotate dehydrogenase (quinone) OS=Cyanothece sp. (strain PCC 8801) GN=pyrD PE=3 SV=1 185 510 4.0E-39
sp|A8FW61|PYRD_SHESH Dihydroorotate dehydrogenase (quinone) OS=Shewanella sediminis (strain HAW-EB3) GN=pyrD PE=3 SV=1 147 516 4.0E-39
sp|A4W8V7|PYRD_ENT38 Dihydroorotate dehydrogenase (quinone) OS=Enterobacter sp. (strain 638) GN=pyrD PE=3 SV=1 186 514 4.0E-39
sp|Q30R79|PYRD_SULDN Dihydroorotate dehydrogenase (quinone) OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=pyrD PE=3 SV=1 133 520 9.0E-39
sp|Q3MDU0|PYRD_ANAVT Dihydroorotate dehydrogenase (quinone) OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=pyrD PE=3 SV=1 138 519 1.0E-38
sp|Q2NU82|PYRD_SODGM Dihydroorotate dehydrogenase (quinone) OS=Sodalis glossinidius (strain morsitans) GN=pyrD PE=3 SV=1 183 510 1.0E-38
sp|B3DX48|PYRD_METI4 Dihydroorotate dehydrogenase (quinone) OS=Methylacidiphilum infernorum (isolate V4) GN=pyrD PE=3 SV=1 185 515 2.0E-38
sp|B1WUM4|PYRD_CYAA5 Dihydroorotate dehydrogenase (quinone) OS=Cyanothece sp. (strain ATCC 51142) GN=pyrD PE=3 SV=1 136 514 2.0E-38
sp|Q8DLB7|PYRD_THEEB Dihydroorotate dehydrogenase (quinone) OS=Thermosynechococcus elongatus (strain BP-1) GN=pyrD PE=3 SV=1 185 503 3.0E-38
sp|B8F848|PYRD_HAEPS Dihydroorotate dehydrogenase (quinone) OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=pyrD PE=3 SV=1 136 514 3.0E-38
sp|Q8YPC6|PYRD_NOSS1 Dihydroorotate dehydrogenase (quinone) OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pyrD PE=3 SV=1 138 510 4.0E-38
sp|Q7VL56|PYRD_HAEDU Dihydroorotate dehydrogenase (quinone) OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=pyrD PE=3 SV=1 143 514 8.0E-38
sp|B8CPG0|PYRD_SHEPW Dihydroorotate dehydrogenase (quinone) OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=pyrD PE=3 SV=1 142 510 1.0E-37
sp|Q1LT62|PYRD_BAUCH Dihydroorotate dehydrogenase (quinone) OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=pyrD PE=3 SV=1 135 514 1.0E-37
sp|P9WHL1|PYRD_MYCTU Dihydroorotate dehydrogenase (quinone) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pyrD PE=1 SV=1 181 514 2.0E-37
sp|P9WHL0|PYRD_MYCTO Dihydroorotate dehydrogenase (quinone) OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pyrD PE=3 SV=1 181 514 2.0E-37
sp|A5U4G5|PYRD_MYCTA Dihydroorotate dehydrogenase (quinone) OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pyrD PE=3 SV=1 181 514 2.0E-37
sp|P65909|PYRD_MYCBO Dihydroorotate dehydrogenase (quinone) OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pyrD PE=3 SV=1 181 514 2.0E-37
sp|C1AQ55|PYRD_MYCBT Dihydroorotate dehydrogenase (quinone) OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=pyrD PE=3 SV=1 181 514 3.0E-37
sp|A1KKI2|PYRD_MYCBP Dihydroorotate dehydrogenase (quinone) OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pyrD PE=3 SV=1 181 514 3.0E-37
sp|A6Q8G0|PYRD_SULNB Dihydroorotate dehydrogenase (quinone) OS=Sulfurovum sp. (strain NBC37-1) GN=pyrD PE=3 SV=1 185 514 3.0E-37
sp|Q31RJ7|PYRD_SYNE7 Dihydroorotate dehydrogenase (quinone) OS=Synechococcus elongatus (strain PCC 7942) GN=pyrD PE=3 SV=1 181 520 4.0E-37
sp|Q827Q6|PYRD_STRAW Dihydroorotate dehydrogenase (quinone) OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pyrD PE=3 SV=1 140 503 4.0E-37
sp|Q5N2Q8|PYRD_SYNP6 Dihydroorotate dehydrogenase (quinone) OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=pyrD PE=3 SV=1 181 520 4.0E-37
sp|A3N0D6|PYRD_ACTP2 Dihydroorotate dehydrogenase (quinone) OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pyrD PE=3 SV=1 143 515 5.0E-37
sp|B2IU79|PYRD_NOSP7 Dihydroorotate dehydrogenase (quinone) OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=pyrD PE=3 SV=1 138 519 7.0E-37
sp|P57443|PYRD_BUCAI Dihydroorotate dehydrogenase (quinone) OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=pyrD PE=3 SV=1 132 514 1.0E-36
sp|Q2GBY1|PYRD_NOVAD Dihydroorotate dehydrogenase (quinone) OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=pyrD PE=3 SV=1 133 505 2.0E-36
sp|Q7U3U2|PYRD_SYNPX Dihydroorotate dehydrogenase (quinone) OS=Synechococcus sp. (strain WH8102) GN=pyrD PE=3 SV=1 185 519 2.0E-36
sp|B0BP55|PYRD_ACTPJ Dihydroorotate dehydrogenase (quinone) OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=pyrD PE=3 SV=1 143 516 3.0E-36
sp|B3H1B5|PYRD_ACTP7 Dihydroorotate dehydrogenase (quinone) OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pyrD PE=3 SV=1 143 516 5.0E-36
sp|A8LY18|PYRD_SALAI Dihydroorotate dehydrogenase (quinone) OS=Salinispora arenicola (strain CNS-205) GN=pyrD PE=3 SV=1 138 507 1.0E-35
sp|Q6AE78|PYRD_LEIXX Dihydroorotate dehydrogenase (quinone) OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pyrD PE=3 SV=1 140 503 1.0E-35
sp|B1Y3C1|PYRD_LEPCP Dihydroorotate dehydrogenase (quinone) OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=pyrD PE=3 SV=1 185 515 2.0E-35
sp|A4X619|PYRD_SALTO Dihydroorotate dehydrogenase (quinone) OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=pyrD PE=3 SV=1 138 507 2.0E-35
sp|Q72KU3|PYRD_THET2 Dihydroorotate dehydrogenase (quinone) OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pyrD PE=3 SV=1 142 503 2.0E-35
sp|B0CA74|PYRD_ACAM1 Dihydroorotate dehydrogenase (quinone) OS=Acaryochloris marina (strain MBIC 11017) GN=pyrD PE=3 SV=1 181 514 2.0E-35
sp|Q5SK69|PYRD_THET8 Dihydroorotate dehydrogenase (quinone) OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pyrD PE=3 SV=1 186 503 1.0E-34
sp|B9L9P6|PYRD_NAUPA Dihydroorotate dehydrogenase (quinone) OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=pyrD PE=3 SV=1 147 514 2.0E-34
sp|Q8D370|PYRD_WIGBR Dihydroorotate dehydrogenase (quinone) OS=Wigglesworthia glossinidia brevipalpis GN=pyrD PE=3 SV=1 183 510 9.0E-33
sp|Q7V473|PYRD_PROMM Dihydroorotate dehydrogenase (quinone) OS=Prochlorococcus marinus (strain MIT 9313) GN=pyrD PE=3 SV=1 185 519 3.0E-32
sp|Q2JRL7|PYRD_SYNJA Dihydroorotate dehydrogenase (quinone) OS=Synechococcus sp. (strain JA-3-3Ab) GN=pyrD PE=3 SV=1 181 517 4.0E-32
sp|A5CS38|PYRD_CLAM3 Dihydroorotate dehydrogenase (quinone) OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=pyrD PE=3 SV=1 136 503 6.0E-31
sp|B0RIK6|PYRD_CLAMS Dihydroorotate dehydrogenase (quinone) OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=pyrD PE=3 SV=2 136 514 1.0E-30
sp|B6JL11|PYRD_HELP2 Dihydroorotate dehydrogenase (quinone) OS=Helicobacter pylori (strain P12) GN=pyrD PE=3 SV=1 136 514 2.0E-30
sp|B5Z6I2|PYRD_HELPG Dihydroorotate dehydrogenase (quinone) OS=Helicobacter pylori (strain G27) GN=pyrD PE=3 SV=1 136 514 6.0E-30
sp|B2USR9|PYRD_HELPS Dihydroorotate dehydrogenase (quinone) OS=Helicobacter pylori (strain Shi470) GN=pyrD PE=3 SV=1 136 514 1.0E-29
sp|Q9ZM11|PYRD_HELPJ Dihydroorotate dehydrogenase (quinone) OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=pyrD PE=3 SV=1 147 514 3.0E-29
sp|Q5UYF1|PYRD_HALMA Dihydroorotate dehydrogenase (quinone) OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pyrD PE=3 SV=1 175 515 4.0E-29
sp|Q1CU70|PYRD_HELPH Dihydroorotate dehydrogenase (quinone) OS=Helicobacter pylori (strain HPAG1) GN=pyrD PE=3 SV=1 147 514 3.0E-28
sp|Q17WU9|PYRD_HELAH Dihydroorotate dehydrogenase (quinone) OS=Helicobacter acinonychis (strain Sheeba) GN=pyrD PE=3 SV=1 132 514 6.0E-28
sp|O25655|PYRD_HELPY Dihydroorotate dehydrogenase (quinone) OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=pyrD PE=3 SV=1 147 514 2.0E-27
sp|Q58070|PYRDB_METJA Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pyrD PE=3 SV=1 176 514 2.0E-11
sp|Q8EUY2|PYRDB_MYCPE Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit OS=Mycoplasma penetrans (strain HF-2) GN=pyrD PE=3 SV=1 181 491 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0005737 cytoplasm Yes
GO:0003824 catalytic activity No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 107 126 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4629
MPPPRRPPRTARSPPPTPPPVQARIPTTMSVSRLGLQSLGSLQLGPKLGPKLGQVPRCRQAWTSSAATSAATSAA
TSAATAAATASTATAKTAAATAKNKASRRARNWVYGSATAAALVIAYLYTTDTRASMHQWLVPRLLRLVFADAED
AHHAGSAALKTLYQLGLHPRERDASLASAPLALGVWGMELDNPIGISAGLDKEGEIADALFALGAGVVEIGGCTP
LPQPGNARPRVFRVPALEAMVNRYGLNSRGADHVAMQLRHRLRAFARSRGLSEQQVLDGGAGVPPGSLLAGRMLA
VQVAKNKETDERDDVAVALDYAYCVNRLAPYADVLVVNVSSPNTPGLRHLQATEPLTRLLTAVVLEARRTQRKTP
PRVMVKVSPDEDHDSQLAGIVQAVLDSGVDGIIVANTTKRRTGLVPQGLELTPSEQRALMQHGGFSGPATFDHTL
HLVARYRKMLDAHPGEQKVIFASGGITSGKQALAVLHAGASVAMLYTGLVYGGAGTVTSIKQQLKACVDA*
Coding >OphauB2|4629
ATGCCTCCACCACGTCGCCCACCTCGCACAGCGCGCTCTCCGCCACCGACACCACCCCCGGTACAGGCTCGTATC
CCCACGACCATGTCGGTCTCGCGCCTAGGCCTCCAGAGCCTGGGGAGCCTTCAGCTAGGCCCCAAGCTGGGCCCC
AAGCTGGGCCAAGTGCCGCGCTGTCGACAGGCATGGACAAGTAGCGCCGCGACTTCAGCAGCTACTTCAGCAGCT
ACTTCAGCAGCTACTGCAGCAGCTACTGCAAGCACAGCAACAGCAAAGACAGCGGCGGCAACGGCCAAGAACAAG
GCGTCGCGTCGTGCCAGGAACTGGGTCTATGGCAGTGCCACGGCAGCGGCCCTAGTTATCGCCTATCTCTACACG
ACGGACACACGCGCCTCGATGCACCAATGGCTGGTGCCGCGGCTGCTGCGCCTGGTCTTTGCCGATGCCGAGGAT
GCCCATCATGCGGGCAGTGCGGCCCTCAAGACTCTGTACCAGCTAGGGCTGCACCCGCGAGAGCGCGACGCCTCG
CTGGCCTCGGCGCCGCTGGCTCTGGGCGTGTGGGGCATGGAGCTCGACAACCCCATTGGCATCTCGGCCGGGCTG
GACAAGGAGGGCGAGATTGCCGATGCGCTGTTTGCGCTGGGCGCCGGCGTGGTTGAGATTGGCGGCTGCACGCCC
CTGCCACAGCCCGGCAACGCCCGCCCGCGCGTCTTTCGCGTGCCGGCCCTCGAGGCCATGGTGAATCGATATGGG
CTCAACTCGCGCGGCGCAGACCATGTGGCCATGCAGCTGCGCCACCGGCTGCGCGCCTTTGCCCGCTCGCGGGGC
CTGAGCGAGCAGCAGGTGCTCGACGGCGGCGCGGGCGTGCCTCCAGGCAGTCTGCTAGCCGGCCGAATGCTGGCG
GTGCAGGTGGCCAAGAACAAGGAGACGGACGAGCGCGACGACGTGGCCGTGGCCCTCGACTACGCCTACTGCGTC
AACCGCCTGGCGCCCTATGCCGACGTGCTGGTGGTCAACGTCAGCAGCCCCAACACGCCCGGCCTCCGCCATCTC
CAGGCCACGGAGCCCCTGACCAGACTCTTGACGGCCGTGGTGCTCGAGGCGCGCCGCACGCAGCGCAAGACGCCG
CCCCGCGTCATGGTCAAGGTGTCGCCCGACGAGGACCACGACTCTCAGCTGGCAGGCATAGTCCAGGCCGTCCTC
GACAGCGGCGTCGACGGCATCATTGTCGCCAACACCACCAAGCGCCGCACAGGCCTGGTGCCCCAGGGCCTCGAG
CTGACGCCCAGCGAGCAGAGAGCCCTCATGCAGCACGGCGGCTTCTCCGGCCCTGCCACCTTTGACCATACCCTA
CACCTGGTGGCCAGGTATCGCAAGATGCTTGATGCCCACCCGGGCGAGCAAAAAGTCATTTTTGCATCCGGTGGC
ATCACCAGCGGCAAGCAGGCCCTGGCTGTGCTGCACGCAGGCGCCAGCGTCGCCATGCTGTACACGGGGCTGGTT
TATGGGGGCGCAGGAACCGTGACGAGCATCAAGCAGCAGCTCAAGGCCTGTGTCGATGCTTGA
Transcript >OphauB2|4629
ATGCCTCCACCACGTCGCCCACCTCGCACAGCGCGCTCTCCGCCACCGACACCACCCCCGGTACAGGCTCGTATC
CCCACGACCATGTCGGTCTCGCGCCTAGGCCTCCAGAGCCTGGGGAGCCTTCAGCTAGGCCCCAAGCTGGGCCCC
AAGCTGGGCCAAGTGCCGCGCTGTCGACAGGCATGGACAAGTAGCGCCGCGACTTCAGCAGCTACTTCAGCAGCT
ACTTCAGCAGCTACTGCAGCAGCTACTGCAAGCACAGCAACAGCAAAGACAGCGGCGGCAACGGCCAAGAACAAG
GCGTCGCGTCGTGCCAGGAACTGGGTCTATGGCAGTGCCACGGCAGCGGCCCTAGTTATCGCCTATCTCTACACG
ACGGACACACGCGCCTCGATGCACCAATGGCTGGTGCCGCGGCTGCTGCGCCTGGTCTTTGCCGATGCCGAGGAT
GCCCATCATGCGGGCAGTGCGGCCCTCAAGACTCTGTACCAGCTAGGGCTGCACCCGCGAGAGCGCGACGCCTCG
CTGGCCTCGGCGCCGCTGGCTCTGGGCGTGTGGGGCATGGAGCTCGACAACCCCATTGGCATCTCGGCCGGGCTG
GACAAGGAGGGCGAGATTGCCGATGCGCTGTTTGCGCTGGGCGCCGGCGTGGTTGAGATTGGCGGCTGCACGCCC
CTGCCACAGCCCGGCAACGCCCGCCCGCGCGTCTTTCGCGTGCCGGCCCTCGAGGCCATGGTGAATCGATATGGG
CTCAACTCGCGCGGCGCAGACCATGTGGCCATGCAGCTGCGCCACCGGCTGCGCGCCTTTGCCCGCTCGCGGGGC
CTGAGCGAGCAGCAGGTGCTCGACGGCGGCGCGGGCGTGCCTCCAGGCAGTCTGCTAGCCGGCCGAATGCTGGCG
GTGCAGGTGGCCAAGAACAAGGAGACGGACGAGCGCGACGACGTGGCCGTGGCCCTCGACTACGCCTACTGCGTC
AACCGCCTGGCGCCCTATGCCGACGTGCTGGTGGTCAACGTCAGCAGCCCCAACACGCCCGGCCTCCGCCATCTC
CAGGCCACGGAGCCCCTGACCAGACTCTTGACGGCCGTGGTGCTCGAGGCGCGCCGCACGCAGCGCAAGACGCCG
CCCCGCGTCATGGTCAAGGTGTCGCCCGACGAGGACCACGACTCTCAGCTGGCAGGCATAGTCCAGGCCGTCCTC
GACAGCGGCGTCGACGGCATCATTGTCGCCAACACCACCAAGCGCCGCACAGGCCTGGTGCCCCAGGGCCTCGAG
CTGACGCCCAGCGAGCAGAGAGCCCTCATGCAGCACGGCGGCTTCTCCGGCCCTGCCACCTTTGACCATACCCTA
CACCTGGTGGCCAGGTATCGCAAGATGCTTGATGCCCACCCGGGCGAGCAAAAAGTCATTTTTGCATCCGGTGGC
ATCACCAGCGGCAAGCAGGCCCTGGCTGTGCTGCACGCAGGCGCCAGCGTCGCCATGCTGTACACGGGGCTGGTT
TATGGGGGCGCAGGAACCGTGACGAGCATCAAGCAGCAGCTCAAGGCCTGTGTCGATGCTTGA
Gene >OphauB2|4629
ATGCCTCCACCACGTCGCCCACCTCGCACAGCGCGCTCTCCGCCACCGACACCACCCCCGGTACAGGCTCGTATC
CCCACGACCATGTCGGTCTCGCGCCTAGGCCTCCAGAGCCTGGGGAGCCTTCAGCTAGGCCCCAAGCTGGGCCCC
AAGCTGGGCCAAGTGCCGCGCTGTCGACAGGCATGGACAAGTAGCGCCGCGACTTCAGCAGCTACTTCAGCAGCT
ACTTCAGCAGCTACTGCAGCAGCTACTGCAAGCACAGCAACAGCAAAGACAGCGGCGGCAACGGCCAAGAACAAG
GCGTCGCGTCGTGCCAGGAACTGGGTCTATGGCAGTGCCACGGCAGCGGCCCTAGTTATCGCCTATCTCTACACG
ACGGACACACGCGCCTCGATGCACCAATGGCTGGTGCCGCGGCTGCTGCGCCTGGTCTTTGCCGATGCCGAGGAT
GCCCATCATGCGGGCAGTGCGGCCCTCAAGACTCTGTACCAGCTAGGGCTGCACCCGCGAGAGCGCGACGCCTCG
CTGGCCTCGGCGCCGCTGGCTCTGGGCGTGTGGGGCATGGAGCTCGACAACCCCATTGGCATCTCGGCCGGGCTG
GACAAGGAGGGCGAGATTGCCGATGCGCTGTTTGCGCTGGGCGCCGGCGTGGTTGAGATTGGCGGCTGCACGCCC
CTGCCACAGCCCGGCAACGCCCGCCCGCGCGTCTTTCGCGTGCCGGCCCTCGAGGCCATGGTGAATCGATATGGG
CTCAACTCGCGCGGCGCAGACCATGTGGCCATGCAGCTGCGCCACCGGCTGCGCGCCTTTGCCCGCTCGCGGGGC
CTGAGCGAGCAGCAGGTGCTCGACGGCGGCGCGGGCGTGCCTCCAGGCAGTCTGCTAGCCGGCCGAATGCTGGCG
GTGCAGGTGGCCAAGAACAAGGAGACGGACGAGCGCGACGACGTGGCCGTGGCCCTCGACTACGCCTACTGCGTC
AACCGCCTGGCGCCCTATGCCGACGTGCTGGTGGTCAACGTCAGCAGCCCCAACACGCCCGGCCTCCGCCATCTC
CAGGCCACGGAGCCCCTGACCAGACTCTTGACGGCCGTGGTGCTCGAGGCGCGCCGCACGCAGCGCAAGACGCCG
CCCCGCGTCATGGTCAAGGTGTCGCCCGACGAGGACCACGACTCTCAGCTGGCAGGCATAGTCCAGGCCGTCCTC
GACAGCGGCGTCGACGGCATCATTGTCGCCAACACCACCAAGCGCCGCACAGGCCTGGTGCCCCAGGGCCTCGAG
CTGACGCCCAGCGAGCAGAGAGCCCTCATGCAGCACGGCGGCTTCTCCGGCCCTGCCACCTTTGACCATACCCTA
CACCTGGTGGCCAGGTATCGCAAGATGCTTGATGCCCACCCGGGCGAGCAAAAAGTCATTTTTGCATCCGGTGGC
ATCACCAGCGGCAAGCAGGCCCTGGCTGTGCTGCACGCAGGCGCCAGCGTCGCCATGCTGTACACGGGGCTGGTT
TATGGGGGCGCAGGAACCGTGACGAGCATCAAGCAGCAGCTCAAGGCCTGTGTCGATGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail