Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4602
Gene name
LocationContig_31:5458..6799
Strand+
Gene length (bp)1341
Transcript length (bp)1002
Coding sequence length (bp)1002
Protein length (aa) 334

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase 4.8E-37 26 195
PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase 8.6E-27 198 326
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 2.1E-06 26 127

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9V8M5|3HIDH_DROME Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Drosophila melanogaster GN=CG15093 PE=2 SV=2 27 323 7.0E-66
sp|P29266|3HIDH_RAT 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Hibadh PE=1 SV=3 27 330 1.0E-63
sp|Q99L13|3HIDH_MOUSE 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Mus musculus GN=Hibadh PE=1 SV=1 27 332 1.0E-63
sp|Q9XTI0|3HIDH_CAEEL Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=B0250.5 PE=3 SV=1 27 326 3.0E-62
sp|P31937|3HIDH_HUMAN 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens GN=HIBADH PE=1 SV=2 27 330 4.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9V8M5|3HIDH_DROME Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Drosophila melanogaster GN=CG15093 PE=2 SV=2 27 323 7.0E-66
sp|P29266|3HIDH_RAT 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Hibadh PE=1 SV=3 27 330 1.0E-63
sp|Q99L13|3HIDH_MOUSE 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Mus musculus GN=Hibadh PE=1 SV=1 27 332 1.0E-63
sp|Q9XTI0|3HIDH_CAEEL Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=B0250.5 PE=3 SV=1 27 326 3.0E-62
sp|P31937|3HIDH_HUMAN 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens GN=HIBADH PE=1 SV=2 27 330 4.0E-60
sp|Q5R5E7|3HIDH_PONAB 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Pongo abelii GN=HIBADH PE=2 SV=1 27 330 5.0E-60
sp|Q54CX6|3HIDH_DICDI Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=hibA PE=3 SV=1 27 327 1.0E-59
sp|Q9SUC0|3HIDH_ARATH Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=At4g20930 PE=2 SV=3 27 330 2.0E-59
sp|Q2HJD7|3HIDH_BOVIN 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Bos taurus GN=HIBADH PE=2 SV=1 27 330 3.0E-59
sp|P28811|MMSB_PSEAE 3-hydroxyisobutyrate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mmsB PE=2 SV=1 28 330 2.0E-55
sp|Q9I5I6|SERDH_PSEAE NAD-dependent L-serine dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA0743 PE=1 SV=1 23 327 2.0E-42
sp|P9WNY5|MMSB_MYCTU Probable 3-hydroxyisobutyrate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmsB PE=1 SV=1 28 329 1.0E-41
sp|P9WNY4|MMSB_MYCTO Probable 3-hydroxyisobutyrate dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mmsB PE=3 SV=1 28 329 1.0E-41
sp|P63936|MMSB_MYCBO Probable 3-hydroxyisobutyrate dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mmsB PE=3 SV=1 28 329 1.0E-41
sp|Q0QLF5|HMGD_EUBBA 2-(hydroxymethyl)glutarate dehydrogenase OS=Eubacterium barkeri GN=Hgd PE=1 SV=1 25 306 3.0E-37
sp|P77161|GLXR_ECOLI 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli (strain K12) GN=glxR PE=2 SV=1 25 289 2.0E-23
sp|P0ABQ3|GARR_ECOL6 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=garR PE=3 SV=1 25 300 3.0E-23
sp|P0ABQ2|GARR_ECOLI 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli (strain K12) GN=garR PE=1 SV=1 25 300 3.0E-23
sp|P0A9V9|SQUU_SHIFL 3-sulfolactaldehyde reductase OS=Shigella flexneri GN=yihU PE=3 SV=1 28 326 3.0E-23
sp|P0A9V8|SQUU_ECOLI 3-sulfolactaldehyde reductase OS=Escherichia coli (strain K12) GN=yihU PE=1 SV=1 28 326 3.0E-23
sp|Q9L7S0|SQUU_SALTY 3-sulfolactaldehyde reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yihU PE=3 SV=1 28 324 3.0E-22
sp|O34948|YKWC_BACSU Uncharacterized oxidoreductase YkwC OS=Bacillus subtilis (strain 168) GN=ykwC PE=3 SV=1 27 307 2.0E-18
sp|O33730|Y1503_SHEFN Uncharacterized oxidoreductase Sfri_1503 OS=Shewanella frigidimarina (strain NCIMB 400) GN=Sfri_1503 PE=3 SV=2 25 309 6.0E-16
sp|Q9SZE1|3HID1_ARATH Probable 3-hydroxyisobutyrate dehydrogenase-like 1, mitochondrial OS=Arabidopsis thaliana GN=At4g29120 PE=1 SV=1 25 285 2.0E-14
sp|F4I907|GLYR2_ARATH Glyoxylate/succinic semialdehyde reductase 2, chloroplastic OS=Arabidopsis thaliana GN=GLYR2 PE=1 SV=1 11 326 5.0E-14
sp|Q55702|Y229_SYNY3 Uncharacterized oxidoreductase slr0229 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0229 PE=3 SV=1 22 210 6.0E-14
sp|Q9LSV0|GLYR1_ARATH Glyoxylate/succinic semialdehyde reductase 1 OS=Arabidopsis thaliana GN=GLYR1 PE=1 SV=1 27 324 9.0E-11
sp|O34969|YFJR_BACSU Uncharacterized oxidoreductase YfjR OS=Bacillus subtilis (strain 168) GN=yfjR PE=3 SV=2 25 306 5.0E-10
sp|P9WNY3|Y770_MYCTU Uncharacterized oxidoreductase Rv0770 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0770 PE=1 SV=1 25 301 1.0E-07
sp|P9WNY2|Y770_MYCTO Uncharacterized oxidoreductase MT0794 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0794 PE=3 SV=1 25 301 1.0E-07
sp|Q922P9|GLYR1_MOUSE Putative oxidoreductase GLYR1 OS=Mus musculus GN=Glyr1 PE=1 SV=1 25 324 4.0E-07
sp|Q5R7T2|GLYR1_PONAB Putative oxidoreductase GLYR1 OS=Pongo abelii GN=GLYR1 PE=2 SV=2 25 324 5.0E-07
sp|Q5ZLS7|GLYR1_CHICK Putative oxidoreductase GLYR1 OS=Gallus gallus GN=GLYR1 PE=2 SV=1 25 324 1.0E-06
sp|Q5RKH0|GLYR1_RAT Putative oxidoreductase GLYR1 OS=Rattus norvegicus GN=Glyr1 PE=1 SV=1 25 324 1.0E-06
sp|A4FUF0|GLYR1_BOVIN Putative oxidoreductase GLYR1 OS=Bos taurus GN=GLYR1 PE=2 SV=1 25 324 2.0E-06
sp|Q49A26|GLYR1_HUMAN Putative oxidoreductase GLYR1 OS=Homo sapiens GN=GLYR1 PE=1 SV=3 25 324 2.0E-06
sp|Q9C991|3HID2_ARATH Probable 3-hydroxyisobutyrate dehydrogenase-like 2, mitochondrial OS=Arabidopsis thaliana GN=At1g71170 PE=2 SV=1 150 282 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0051287 NAD binding Yes
GO:0050661 NADP binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4602
MRLAQHLRGVVQTRMFCTSPRRLDRYGFIGLGQMGYQMAKNLQSKLSARDAVSIFDINPQAMSGLEADMNKAPHA
ARVELAASAQDACKDADLVITVLPEPQHVLAVYQSITSNPQAPADRVLIDCSTIDPSTSRQVAKMMADAGQGTFV
DAPMSGGVVGATAATLTFMLGAPSALVPRVEPALLLMGRKVLHCGAQGAGLSAKLANNYLLALNNIATAEAMNLG
MRWGLDAATLAGVINVSTGRCWPSEVNNPVKGVVQTAAAARDYRGGFGISLMKKDLGLAMVAAKEADAKMALADA
AYAVYDEAEKRPDCSGRDFSVVYRYLDGKEPHD*
Coding >OphauB2|4602
ATGCGACTTGCTCAGCATCTGCGAGGCGTCGTGCAGACGCGCATGTTTTGCACGTCGCCGCGCCGCTTGGATAGG
TATGGCTTCATTGGCCTAGGCCAGATGGGATACCAAATGGCAAAGAATCTGCAGTCCAAGCTCTCGGCAAGGGAT
GCAGTCTCCATCTTTGACATTAATCCTCAGGCCATGAGTGGCCTCGAGGCCGACATGAACAAGGCGCCCCATGCC
GCCAGGGTCGAGTTGGCTGCCAGTGCCCAAGACGCCTGCAAGGATGCCGACCTAGTCATTACCGTTCTGCCTGAA
CCACAGCACGTCCTTGCAGTCTACCAGTCCATCACGTCCAACCCTCAAGCACCCGCCGACCGCGTCTTGATCGAC
TGCTCAACTATCGACCCCTCCACCTCCCGCCAGGTGGCCAAGATGATGGCCGACGCAGGCCAGGGCACCTTTGTC
GACGCCCCAATGTCTGGTGGCGTCGTCGGCGCCACCGCGGCCACGCTAACCTTTATGCTTGGCGCCCCCTCGGCC
TTGGTGCCCAGAGTCGAGCCGGCCCTTTTGCTCATGGGCCGCAAGGTGCTTCACTGCGGTGCCCAGGGCGCCGGC
CTCTCGGCAAAGCTTGCAAACAACTACCTCCTTGCCCTCAACAATATTGCCACGGCAGAGGCAATGAACCTGGGC
ATGCGCTGGGGCCTCGACGCCGCTACTCTTGCCGGCGTCATCAACGTGAGCACCGGCCGCTGCTGGCCCAGCGAG
GTGAATAACCCTGTAAAGGGCGTCGTTCAAACCGCTGCTGCCGCTCGAGACTACCGTGGCGGCTTCGGCATCTCC
CTCATGAAGAAGGACCTTGGTCTTGCCATGGTTGCTGCAAAGGAGGCTGACGCTAAGATGGCGCTCGCTGATGCC
GCCTACGCGGTGTACGACGAAGCTGAGAAGCGCCCAGACTGCAGTGGCCGCGACTTTTCTGTTGTGTACCGCTAT
CTCGACGGCAAGGAGCCTCATGACTAG
Transcript >OphauB2|4602
ATGCGACTTGCTCAGCATCTGCGAGGCGTCGTGCAGACGCGCATGTTTTGCACGTCGCCGCGCCGCTTGGATAGG
TATGGCTTCATTGGCCTAGGCCAGATGGGATACCAAATGGCAAAGAATCTGCAGTCCAAGCTCTCGGCAAGGGAT
GCAGTCTCCATCTTTGACATTAATCCTCAGGCCATGAGTGGCCTCGAGGCCGACATGAACAAGGCGCCCCATGCC
GCCAGGGTCGAGTTGGCTGCCAGTGCCCAAGACGCCTGCAAGGATGCCGACCTAGTCATTACCGTTCTGCCTGAA
CCACAGCACGTCCTTGCAGTCTACCAGTCCATCACGTCCAACCCTCAAGCACCCGCCGACCGCGTCTTGATCGAC
TGCTCAACTATCGACCCCTCCACCTCCCGCCAGGTGGCCAAGATGATGGCCGACGCAGGCCAGGGCACCTTTGTC
GACGCCCCAATGTCTGGTGGCGTCGTCGGCGCCACCGCGGCCACGCTAACCTTTATGCTTGGCGCCCCCTCGGCC
TTGGTGCCCAGAGTCGAGCCGGCCCTTTTGCTCATGGGCCGCAAGGTGCTTCACTGCGGTGCCCAGGGCGCCGGC
CTCTCGGCAAAGCTTGCAAACAACTACCTCCTTGCCCTCAACAATATTGCCACGGCAGAGGCAATGAACCTGGGC
ATGCGCTGGGGCCTCGACGCCGCTACTCTTGCCGGCGTCATCAACGTGAGCACCGGCCGCTGCTGGCCCAGCGAG
GTGAATAACCCTGTAAAGGGCGTCGTTCAAACCGCTGCTGCCGCTCGAGACTACCGTGGCGGCTTCGGCATCTCC
CTCATGAAGAAGGACCTTGGTCTTGCCATGGTTGCTGCAAAGGAGGCTGACGCTAAGATGGCGCTCGCTGATGCC
GCCTACGCGGTGTACGACGAAGCTGAGAAGCGCCCAGACTGCAGTGGCCGCGACTTTTCTGTTGTGTACCGCTAT
CTCGACGGCAAGGAGCCTCATGACTAG
Gene >OphauB2|4602
ATGCGACTTGCTCAGCATCTGCGAGGCGTCGTGCAGACGCGCATGTTTTGCACGTCGCCGCGCCGCTTGGATAGG
TATGGCTTCATTGGCCTAGGCCAGATGGTGAGTTGTTCAATGTTTACAACTGGTTTTTTATTTTGACCTGGCAGA
GGCGCTGACCATCTTTTTTTTCTTTTTTGCTCCCTTTGGAATCGCAAAGGGATACCAAATGGCAAAGAATCTGCA
GTCCAAGCTCTCGGCAAGGGATGCAGTCTCCATCTTTGACATTAATCCTCAGGCCATGAGTGGCCTCGAGGCCGA
CATGAACAAGGCGCCCCATGCCGCCAGGGTCGAGTTGGCTGCCAGTGCCCAAGACGCCTGCAAGGATGCCGTATG
TATTCCTGTCCTCATACCAAACTACTACATAATGCTCTGCCCGCTGCAAAATGATGAAGTATTATTGTTCTATCT
ATGATCTAAGTTGGGGCTCAGTGGGTAGACAGCCTGCTGGCCCTTTTCTGATTACGAAACAATTAAAGCCAATCC
TCTGATGTCCGCTCTATTTACAAAAAAAAAACACCAAAGATAAATTTGCACACCCTATTTATGAGCTTGGCGCTA
ACCTCTCTTTAGGACCTAGTCATTACCGTTCTGCCTGAACCACAGCACGTCCTTGCAGTCTACCAGTCCATCACG
TCCAACCCTCAAGCACCCGCCGACCGCGTCTTGATCGACTGCTCAACTATCGACCCCTCCACCTCCCGCCAGGTG
GCCAAGATGATGGCCGACGCAGGCCAGGGCACCTTTGTCGACGCCCCAATGTCTGGTGGCGTCGTCGGCGCCACC
GCGGCCACGCTAACCTTTATGCTTGGCGCCCCCTCGGCCTTGGTGCCCAGAGTCGAGCCGGCCCTTTTGCTCATG
GGCCGCAAGGTGCTTCACTGCGGTGCCCAGGGCGCCGGCCTCTCGGCAAAGCTTGCAAACAACTACCTCCTTGCC
CTCAACAATATTGCCACGGCAGAGGCAATGAACCTGGGCATGCGCTGGGGCCTCGACGCCGCTACTCTTGCCGGC
GTCATCAACGTGAGCACCGGCCGCTGCTGGCCCAGCGAGGTGAATAACCCTGTAAAGGGCGTCGTTCAAACCGCT
GCTGCCGCTCGAGACTACCGTGGCGGCTTCGGCATCTCCCTCATGAAGAAGGACCTTGGTCTTGCCATGGTTGCT
GCAAAGGAGGCTGACGCTAAGATGGCGCTCGCTGATGCCGCCTACGCGGTGTACGACGAAGCTGAGAAGCGCCCA
GACTGCAGTGGCCGCGACTTTTCTGTTGTGTACCGCTATCTCGACGGCAAGGAGCCTCATGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail