Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4599
Gene name
LocationContig_309:4032..6564
Strand-
Gene length (bp)2532
Transcript length (bp)1536
Coding sequence length (bp)1536
Protein length (aa) 512

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase 5.5E-70 11 278
PF03070 TENA_THI-4 TENA/THI-4/PQQC family 2.8E-45 302 507

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94266|THI22_SCHPO Putative hydroxymethylpyrimidine/phosphomethylpyrimidine kinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.18c PE=3 SV=1 5 506 9.0E-124
sp|O94265|THI21_SCHPO Putative hydroxymethylpyrimidine/phosphomethylpyrimidine kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.17c PE=3 SV=1 5 488 5.0E-66
sp|Q06490|THI22_YEAST Thiamine biosynthesis protein THI22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI22 PE=2 SV=2 4 505 2.0E-59
sp|Q08224|THI20_YEAST Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase THI20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI20 PE=1 SV=1 4 505 5.0E-58
sp|Q08975|THI21_YEAST Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase THI21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI21 PE=1 SV=1 4 505 5.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94266|THI22_SCHPO Putative hydroxymethylpyrimidine/phosphomethylpyrimidine kinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.18c PE=3 SV=1 5 506 9.0E-124
sp|O94265|THI21_SCHPO Putative hydroxymethylpyrimidine/phosphomethylpyrimidine kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.17c PE=3 SV=1 5 488 5.0E-66
sp|Q06490|THI22_YEAST Thiamine biosynthesis protein THI22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI22 PE=2 SV=2 4 505 2.0E-59
sp|Q08224|THI20_YEAST Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase THI20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI20 PE=1 SV=1 4 505 5.0E-58
sp|Q08975|THI21_YEAST Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase THI21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI21 PE=1 SV=1 4 505 5.0E-53
sp|Q8FTH8|THIED_COREF Thiamine biosynthesis multifunctional protein ThiED OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=thiED PE=3 SV=1 3 506 2.0E-48
sp|P61422|THIED_GEOSL Thiamine biosynthesis bifunctional protein ThiED OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=thiDE PE=3 SV=1 2 281 8.0E-45
sp|P44659|Y358_HAEIN Uncharacterized protein HI_0358 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0358 PE=3 SV=1 305 507 1.0E-44
sp|Q8NQH1|THIED_CORGL Thiamine biosynthesis multifunctional protein ThiED OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=theD PE=3 SV=2 3 506 5.0E-43
sp|Q5M731|TPS1L_ARATH Thiamine biosynthetic bifunctional enzyme TH1, chloroplastic OS=Arabidopsis thaliana GN=TH1 PE=1 SV=1 3 310 7.0E-43
sp|O48881|TPS1_BRANA Thiamine biosynthetic bifunctional enzyme BTH1, chloroplastic OS=Brassica napus GN=BTH1 PE=1 SV=1 1 312 2.0E-40
sp|P76422|THID_ECOLI Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Escherichia coli (strain K12) GN=thiD PE=1 SV=1 1 283 8.0E-40
sp|P55882|THID_SALTY Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=thiD PE=1 SV=2 5 283 1.0E-39
sp|Q9ZBL1|THID_MYCLE Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Mycobacterium leprae (strain TN) GN=thiD PE=3 SV=1 3 281 1.0E-38
sp|Q8NVH3|THID_STAAW Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Staphylococcus aureus (strain MW2) GN=thiD PE=3 SV=1 5 281 1.0E-35
sp|Q6G7L7|THID_STAAS Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Staphylococcus aureus (strain MSSA476) GN=thiD PE=3 SV=1 5 281 1.0E-35
sp|P66914|THID_MYCBO Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=thiD PE=3 SV=1 3 284 2.0E-35
sp|P9WG76|THID_MYCTO Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=thiD PE=3 SV=1 3 284 2.0E-35
sp|Q6GEY2|THID_STAAR Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Staphylococcus aureus (strain MRSA252) GN=thiD PE=3 SV=1 5 281 2.0E-35
sp|O31620|THID_BACSU Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Bacillus subtilis (strain 168) GN=thiD PE=1 SV=1 30 281 2.0E-35
sp|P9WG77|THID_MYCTU Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=thiD PE=1 SV=1 3 284 2.0E-35
sp|P99124|THID_STAAN Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Staphylococcus aureus (strain N315) GN=thiD PE=1 SV=1 5 281 3.0E-35
sp|P66915|THID_STAAM Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=thiD PE=3 SV=1 5 281 3.0E-35
sp|Q9ZBR6|THID_STRCO Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=thiD PE=3 SV=1 18 280 4.0E-35
sp|P56904|THID_RHIME Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Rhizobium meliloti (strain 1021) GN=thiD PE=3 SV=2 18 282 1.0E-34
sp|P39610|PDXK_BACSU Pyridoxine kinase OS=Bacillus subtilis (strain 168) GN=pdxK PE=1 SV=1 1 280 8.0E-34
sp|O67772|THID_AQUAE Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Aquifex aeolicus (strain VF5) GN=thiD PE=3 SV=1 5 275 8.0E-33
sp|Q2QWK9|TPS1_ORYSJ Probable thiamine biosynthetic bifunctional enzyme, chloroplastic OS=Oryza sativa subsp. japonica GN=Os12g0192500 PE=2 SV=2 18 314 3.0E-32
sp|P44697|THID_HAEIN Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thiD PE=3 SV=1 18 280 3.0E-30
sp|Q9USL6|YJK5_SCHPO Putative hydroxymethylpyrimidine/phosphomethylpyrimidine kinase C18B5.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18B5.05c PE=3 SV=1 5 266 3.0E-28
sp|O85786|THID_SYNE7 Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Synechococcus elongatus (strain PCC 7942) GN=thiD PE=3 SV=2 18 284 3.0E-27
sp|Q9K9G8|TENA_BACHD Aminopyrimidine aminohydrolase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=tenA PE=1 SV=1 306 507 4.0E-25
sp|Q9ZL00|THID_HELPJ Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=thiD PE=3 SV=1 18 279 5.0E-24
sp|O25515|THID_HELPY Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=thiD PE=3 SV=1 18 279 1.0E-22
sp|Q8CTQ7|PDXK_STAES Putative pyridoxine kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pdxK PE=3 SV=1 1 280 1.0E-20
sp|Q5HI96|PDXK_STAAC Putative pyridoxine kinase OS=Staphylococcus aureus (strain COL) GN=pdxK PE=3 SV=1 1 280 2.0E-20
sp|Q5HRG7|PDXK_STAEQ Putative pyridoxine kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pdxK PE=3 SV=2 1 280 4.0E-20
sp|A8KRL3|TENA_HELPX Aminopyrimidine aminohydrolase OS=Helicobacter pylori GN=tenA PE=1 SV=1 302 507 2.0E-19
sp|O83153|PDXK_TREPA Putative pyridoxine kinase OS=Treponema pallidum (strain Nichols) GN=pdxK PE=3 SV=1 18 266 5.0E-17
sp|Q57688|THIDN_METJA Bifunctional thiamine biosynthesis protein ThiDN OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=thiDN PE=1 SV=2 4 277 2.0E-15
sp|P25052|TENA_BACSU Aminopyrimidine aminohydrolase OS=Bacillus subtilis (strain 168) GN=tenA PE=1 SV=1 301 507 1.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5629
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4501
Ophiocordyceps australis map64 (Brazil) OphauB2|4599 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01748
Ophiocordyceps camponoti-rufipedis Ophun1|2213
Ophiocordyceps kimflemingae Ophio5|4948
Ophiocordyceps subramaniannii Hirsu2|7720

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4599
MGRVLLVGGSDCSGGAGLEAGQRVVAAHGCYALTATTALTAQDTKGVWGVHVVPARFVEQQMEACLDDVGADVIV
TGMLASSDTVEAVAAQVQRRGLPVIVDPVVAATAGTELLPPAALQTLLARLLPLTTLLTPNLPEARLILGHDAPV
ESPADLELLARRIQALGPRWVLVKGGHLPLPASACQSAPPTARVVVDVLVGPNAPALHLVSPWQHTSSTHGTGCT
LAAAIAALLARSILHHGHAHLHSDIPPAVRAACRYVEAAIRAAPGFGRGHGPLGHLHSLCLLPFAPGYFVEYLLA
RPDVSPVWHRFLNHPFVHALGHASLPLDSFKGYLVQDYLFLLHFSRAHALAAYKAQTIDDISAAAQTMAQICRET
NLHLSYCHSFGISLSDIKATPEHQACIAYTRYVLDIGHTADALALRMALFPCLLGYAAVAAALDSSPSTLRHDAN
PYWPWIQNYLADDYCRTVESGSRLIEDQMRLQSPSRIQEYINTFIHATRMEIAFWDMFPSS*
Coding >OphauB2|4599
ATGGGACGCGTGTTGCTGGTGGGCGGGTCAGACTGTTCAGGCGGAGCGGGCCTCGAGGCCGGACAGCGCGTGGTG
GCGGCGCATGGCTGCTATGCCCTGACGGCGACGACGGCGCTGACGGCCCAAGACACCAAGGGCGTTTGGGGGGTG
CACGTGGTGCCGGCGCGCTTCGTGGAGCAGCAGATGGAGGCGTGCCTCGACGACGTGGGCGCCGACGTGATTGTC
ACGGGCATGCTGGCATCGTCAGACACAGTCGAGGCCGTGGCAGCCCAGGTGCAGCGGCGCGGCCTGCCCGTCATT
GTCGACCCCGTCGTCGCCGCCACGGCCGGCACGGAGCTGCTCCCCCCCGCCGCCCTGCAGACGCTGCTTGCGCGC
CTCCTCCCCCTGACGACGCTGCTCACGCCCAACCTGCCCGAGGCCCGCCTCATCCTCGGCCACGACGCCCCCGTT
GAGTCGCCCGCCGACTTGGAGCTCCTCGCCCGCCGCATCCAGGCCCTTGGCCCGCGCTGGGTCCTCGTCAAGGGC
GGCCACTTGCCGCTGCCTGCCTCGGCTTGCCAGAGTGCTCCCCCCACCGCCCGCGTCGTCGTCGACGTGCTCGTC
GGCCCCAACGCCCCTGCTCTCCACCTCGTCAGTCCTTGGCAGCACACCTCGAGCACCCACGGCACTGGCTGTACT
CTGGCTGCTGCCATTGCCGCTCTCCTCGCCCGCTCCATCCTCCACCATGGCCACGCCCACTTGCACAGCGACATC
CCCCCCGCCGTCCGCGCTGCCTGCCGCTACGTCGAGGCTGCCATCCGCGCTGCCCCCGGCTTTGGTCGTGGCCAC
GGCCCCTTGGGACACTTGCATTCCCTCTGCCTCCTCCCCTTTGCCCCCGGCTACTTTGTCGAATATCTCCTCGCC
CGTCCCGACGTCAGCCCCGTCTGGCACCGCTTCCTCAATCATCCTTTCGTCCACGCCCTTGGCCACGCCTCCTTG
CCCCTCGACTCCTTCAAGGGCTACCTGGTCCAGGACTATCTCTTCCTTCTTCACTTTTCCCGCGCACACGCTCTC
GCCGCCTACAAGGCCCAGACCATTGACGACATATCCGCTGCCGCCCAAACCATGGCCCAGATTTGCCGTGAAACA
AACTTGCATCTCTCCTATTGTCACTCGTTTGGCATTTCTCTCTCTGACATCAAGGCCACCCCTGAACACCAAGCC
TGCATTGCCTACACCCGCTATGTTCTCGATATTGGCCACACTGCCGACGCTTTAGCCCTCCGCATGGCCCTGTTT
CCCTGTCTGCTCGGCTACGCCGCCGTCGCTGCTGCCCTTGATTCCTCGCCGAGCACCCTTCGCCATGATGCTAAT
CCCTACTGGCCTTGGATTCAGAATTACCTCGCCGACGACTACTGCCGCACCGTTGAATCTGGCTCTCGTCTCATT
GAAGATCAAATGCGCCTACAGTCGCCAAGCCGCATTCAAGAATACATCAATACTTTTATCCACGCTACAAGAATG
GAAATAGCATTTTGGGACATGTTTCCGTCAAGCTGA
Transcript >OphauB2|4599
ATGGGACGCGTGTTGCTGGTGGGCGGGTCAGACTGTTCAGGCGGAGCGGGCCTCGAGGCCGGACAGCGCGTGGTG
GCGGCGCATGGCTGCTATGCCCTGACGGCGACGACGGCGCTGACGGCCCAAGACACCAAGGGCGTTTGGGGGGTG
CACGTGGTGCCGGCGCGCTTCGTGGAGCAGCAGATGGAGGCGTGCCTCGACGACGTGGGCGCCGACGTGATTGTC
ACGGGCATGCTGGCATCGTCAGACACAGTCGAGGCCGTGGCAGCCCAGGTGCAGCGGCGCGGCCTGCCCGTCATT
GTCGACCCCGTCGTCGCCGCCACGGCCGGCACGGAGCTGCTCCCCCCCGCCGCCCTGCAGACGCTGCTTGCGCGC
CTCCTCCCCCTGACGACGCTGCTCACGCCCAACCTGCCCGAGGCCCGCCTCATCCTCGGCCACGACGCCCCCGTT
GAGTCGCCCGCCGACTTGGAGCTCCTCGCCCGCCGCATCCAGGCCCTTGGCCCGCGCTGGGTCCTCGTCAAGGGC
GGCCACTTGCCGCTGCCTGCCTCGGCTTGCCAGAGTGCTCCCCCCACCGCCCGCGTCGTCGTCGACGTGCTCGTC
GGCCCCAACGCCCCTGCTCTCCACCTCGTCAGTCCTTGGCAGCACACCTCGAGCACCCACGGCACTGGCTGTACT
CTGGCTGCTGCCATTGCCGCTCTCCTCGCCCGCTCCATCCTCCACCATGGCCACGCCCACTTGCACAGCGACATC
CCCCCCGCCGTCCGCGCTGCCTGCCGCTACGTCGAGGCTGCCATCCGCGCTGCCCCCGGCTTTGGTCGTGGCCAC
GGCCCCTTGGGACACTTGCATTCCCTCTGCCTCCTCCCCTTTGCCCCCGGCTACTTTGTCGAATATCTCCTCGCC
CGTCCCGACGTCAGCCCCGTCTGGCACCGCTTCCTCAATCATCCTTTCGTCCACGCCCTTGGCCACGCCTCCTTG
CCCCTCGACTCCTTCAAGGGCTACCTGGTCCAGGACTATCTCTTCCTTCTTCACTTTTCCCGCGCACACGCTCTC
GCCGCCTACAAGGCCCAGACCATTGACGACATATCCGCTGCCGCCCAAACCATGGCCCAGATTTGCCGTGAAACA
AACTTGCATCTCTCCTATTGTCACTCGTTTGGCATTTCTCTCTCTGACATCAAGGCCACCCCTGAACACCAAGCC
TGCATTGCCTACACCCGCTATGTTCTCGATATTGGCCACACTGCCGACGCTTTAGCCCTCCGCATGGCCCTGTTT
CCCTGTCTGCTCGGCTACGCCGCCGTCGCTGCTGCCCTTGATTCCTCGCCGAGCACCCTTCGCCATGATGCTAAT
CCCTACTGGCCTTGGATTCAGAATTACCTCGCCGACGACTACTGCCGCACCGTTGAATCTGGCTCTCGTCTCATT
GAAGATCAAATGCGCCTACAGTCGCCAAGCCGCATTCAAGAATACATCAATACTTTTATCCACGCTACAAGAATG
GAAATAGCATTTTGGGACATGTTTCCGTCAAGCTGA
Gene >OphauB2|4599
ATGGGACGCGTGTTGCTGGTGGGCGGGTCAGACTGTTCAGGCGGAGCGTAAGCAGCGCGGCGCGTGTTTGCAAGA
AGCAGCGACAGCTAACAGCGGCAGGGGCCTCGAGGCCGGACAGCGCGTGGTGGCGGCGCATGGCTGCTATGCCCT
GACGGCGACGACGGCGCTGACGGCCCAAGACACCAAGGGCGTTTGGGGGGTGCACGTGGTGCCGGCGCGCTTCGT
GGAGCAGCAGATGGAGGCGTGCCTCGACGACGTGGGCGCCGACGTGATTGTCACGGGTAGTAGTCGTCTCTCTTT
TGCCCTTGGTCTATTCTCCTCCTCTTTGCCCTCTATCCTCCTCTTTGCCCTCTATCCTCTTCGCTTTGCCCTTGC
TCTATTCTCCTTCTCCTCTTGACCTTTGCTCTATTCTCCTCGCTTTTGCCCTTGGTCTATTCTCCTCTTGACCTT
TGCTCTATTCTCCTCGCTTTTGCCCTTGGTCTATTCTCCTCTTGACCCTTGCTCTATCCTCCTTTTAACCCTTGC
TCTATTCTCCTTGCTTTTGCCCTCTATCCTCCTCTTTACCATCTATTCTCCTCTTAACCCTTACTCTATTCTCCT
TTTAACCCTTACTCTATCCTCCTCGCTTTTGCCCTTGGTCTATTCTCCTCTTGACCCTTGCTCTATTCTCCTCGC
TTTTGCCCTCGTCGTCTCATGGCCAAGGACCCAATCTCACCAACCCTCCTCCTCCCCCTCCACCCCCATATATAG
GCATGCTGGCATCGTCAGACACAGTCGAGGCCGTGGCAGCCCAGGTGCAGCGGCGCGGCCTGCCCGTCATTGTCG
ACCCCGTCGTCGCCGCCACGGCCGGCACGGAGCTGCTCCCCCCCGCCGCCCTGCAGACGCTGCTTGCGCGCCTCC
TCCCCCTGACGACGCTGCTCACGCCCAACCTGCCCGAGGCCCGCCTCATCCTCGGCCACGACGCCCCCGTTGAGT
CGCCCGCCGACTTGGAGCTCCTCGCCCGCCGCATCCAGGCCCTTGGCCCGCGCTGGGTCCTCGTCAAGGGCGGCC
ACTTGCCGCTGCCTGCCTCGGCTTGCCAGAGTGCTCCCCCCACCGCCCGCGTCGTCGTCGACGTGCTCGTCGGCC
CCAACGCCCCTGCTCTCCACCTCGTCAGTCCTTGGCAGCACACCTCGAGCACCCACGGCACTGGCTGTACTCTGG
CTGCTGCCATTGCCGCTCTCCTCGCCCGCTCCATCCTCCACCATGGCCACGCCCACTTGCACAGCGACATCCCCC
CCGCCGTCCGCGCTGCCTGCCGCTACGTCGAGGCTGCCATCCGCGCTGCCCCCGGCTTTGGTCGTGGCCACGGCC
CCTTGGGACACTTGCATTCCCTCTGCCTCCTCCCCTTTGCCCCGTGAGCCCTCTCCACCTCCCCTGCTGTCCCAG
AGCAAGACTCACCTCTGTCTTTGAAGCGGCTACTTTGTCGAATATCTCCTCGCCCGTCCCGACGTCAGCCCCGTC
TGGCACCGCTTCCTCAATCATCCTTTCGTCCACGCCCTTGGCCACGCCTCCTTGCCCCTCGACTCCTTCAAGGGC
TACCTGGTCCAGGACTATCTCTTCCTTGTTTGTTGCTCTTACCACACACCCTGTCCTGACCAGCCCCTGCTCATG
CCCCAGCCATGTAGCTTCACTTTTCCCGCGCACACGCTCTCGCCGCCTACAAGGCCCAGACCATTGACGACATAT
CCGCTGTATCCGCCTCTCCATCTGTCCCCCTGCCAGAAACTTCCCGCTGATTCTTGTCTGTCTAGGCCGCCCAAA
CCATGGCCCAGATTTGCCGTGAAACAAACTTGCATCTCTCCTATTGTCACTCGTTTGGCATTTCTCTCTCTGACA
TCAAGGCCACCCCTGAACACCAAGGTAATCCCCTCTTGTCGCCTTGTCCTTCTTTTTTCGAGGGGGAGCGGCAGC
GGCACCAAGGGGAAAAAAAGAGGACTGACCCCGTCTTAGCCTGCATTGCCTACACCCGCTATGTTCTCGATATTG
GCCACACTGCCGACGCTTTAGCCCTCCGCATGGCCCTGTTTCCCTGTCTGCTCGGCTACGCCGCCGTCGCTGCTG
CCCTTGATTCCTCGCCGAGCACCCTTCGCCATGATGCTAATCCCTACTGGCCTTGGATTCAGAATTACCTCGCCG
ACGACTACTGCCGCACCGTTGAATCTGGCTCTCGTAAGTGTTTTTGTTTCATCGCTCTCTCAACTCTACTCTTCT
CCTTCTCTATCCTTCCCTCGCCTGACTCGCCCCCTTTCTAGGTCTCATTGAAGATCAAATGCGCCTACAGTCGCC
AAGCCGCATTCAAGAATACATCAATACTTTTATCCACGCTACAAGAGTAAGTCGCCCCCCCCCCCCCAAACTCTC
TTTCAAGATGTCAAAAATCAGTCTTCATCCCTCTCTCCCTACATCTTCAGCATCACAGCTGATTAGGTTCGCCGT
CCTGACAAATTCCAATAGATGGAAATAGCATTTTGGGACATGTTTCCGTCAAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail