Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4599
Gene name
LocationContig_309:4032..6564
Strand-
Gene length (bp)2532
Transcript length (bp)1536
Coding sequence length (bp)1536
Protein length (aa) 512

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase 5.5E-70 11 278
PF03070 TENA_THI-4 TENA/THI-4/PQQC family 2.8E-45 302 507

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94266|THI22_SCHPO Putative hydroxymethylpyrimidine/phosphomethylpyrimidine kinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.18c PE=3 SV=1 5 506 9.0E-124
sp|O94265|THI21_SCHPO Putative hydroxymethylpyrimidine/phosphomethylpyrimidine kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.17c PE=3 SV=1 5 488 5.0E-66
sp|Q06490|THI22_YEAST Thiamine biosynthesis protein THI22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI22 PE=2 SV=2 4 505 2.0E-59
sp|Q08224|THI20_YEAST Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase THI20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI20 PE=1 SV=1 4 505 5.0E-58
sp|Q08975|THI21_YEAST Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase THI21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI21 PE=1 SV=1 4 505 5.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94266|THI22_SCHPO Putative hydroxymethylpyrimidine/phosphomethylpyrimidine kinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.18c PE=3 SV=1 5 506 9.0E-124
sp|O94265|THI21_SCHPO Putative hydroxymethylpyrimidine/phosphomethylpyrimidine kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.17c PE=3 SV=1 5 488 5.0E-66
sp|Q06490|THI22_YEAST Thiamine biosynthesis protein THI22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI22 PE=2 SV=2 4 505 2.0E-59
sp|Q08224|THI20_YEAST Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase THI20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI20 PE=1 SV=1 4 505 5.0E-58
sp|Q08975|THI21_YEAST Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase THI21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI21 PE=1 SV=1 4 505 5.0E-53
sp|Q8FTH8|THIED_COREF Thiamine biosynthesis multifunctional protein ThiED OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=thiED PE=3 SV=1 3 506 2.0E-48
sp|P61422|THIED_GEOSL Thiamine biosynthesis bifunctional protein ThiED OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=thiDE PE=3 SV=1 2 281 8.0E-45
sp|P44659|Y358_HAEIN Uncharacterized protein HI_0358 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0358 PE=3 SV=1 305 507 1.0E-44
sp|Q8NQH1|THIED_CORGL Thiamine biosynthesis multifunctional protein ThiED OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=theD PE=3 SV=2 3 506 5.0E-43
sp|Q5M731|TPS1L_ARATH Thiamine biosynthetic bifunctional enzyme TH1, chloroplastic OS=Arabidopsis thaliana GN=TH1 PE=1 SV=1 3 310 7.0E-43
sp|O48881|TPS1_BRANA Thiamine biosynthetic bifunctional enzyme BTH1, chloroplastic OS=Brassica napus GN=BTH1 PE=1 SV=1 1 312 2.0E-40
sp|P76422|THID_ECOLI Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Escherichia coli (strain K12) GN=thiD PE=1 SV=1 1 283 8.0E-40
sp|P55882|THID_SALTY Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=thiD PE=1 SV=2 5 283 1.0E-39
sp|Q9ZBL1|THID_MYCLE Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Mycobacterium leprae (strain TN) GN=thiD PE=3 SV=1 3 281 1.0E-38
sp|Q8NVH3|THID_STAAW Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Staphylococcus aureus (strain MW2) GN=thiD PE=3 SV=1 5 281 1.0E-35
sp|Q6G7L7|THID_STAAS Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Staphylococcus aureus (strain MSSA476) GN=thiD PE=3 SV=1 5 281 1.0E-35
sp|P66914|THID_MYCBO Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=thiD PE=3 SV=1 3 284 2.0E-35
sp|P9WG76|THID_MYCTO Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=thiD PE=3 SV=1 3 284 2.0E-35
sp|Q6GEY2|THID_STAAR Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Staphylococcus aureus (strain MRSA252) GN=thiD PE=3 SV=1 5 281 2.0E-35
sp|O31620|THID_BACSU Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Bacillus subtilis (strain 168) GN=thiD PE=1 SV=1 30 281 2.0E-35
sp|P9WG77|THID_MYCTU Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=thiD PE=1 SV=1 3 284 2.0E-35
sp|P99124|THID_STAAN Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Staphylococcus aureus (strain N315) GN=thiD PE=1 SV=1 5 281 3.0E-35
sp|P66915|THID_STAAM Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=thiD PE=3 SV=1 5 281 3.0E-35
sp|Q9ZBR6|THID_STRCO Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=thiD PE=3 SV=1 18 280 4.0E-35
sp|P56904|THID_RHIME Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Rhizobium meliloti (strain 1021) GN=thiD PE=3 SV=2 18 282 1.0E-34
sp|P39610|PDXK_BACSU Pyridoxine kinase OS=Bacillus subtilis (strain 168) GN=pdxK PE=1 SV=1 1 280 8.0E-34
sp|O67772|THID_AQUAE Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Aquifex aeolicus (strain VF5) GN=thiD PE=3 SV=1 5 275 8.0E-33
sp|Q2QWK9|TPS1_ORYSJ Probable thiamine biosynthetic bifunctional enzyme, chloroplastic OS=Oryza sativa subsp. japonica GN=Os12g0192500 PE=2 SV=2 18 314 3.0E-32
sp|P44697|THID_HAEIN Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thiD PE=3 SV=1 18 280 3.0E-30
sp|Q9USL6|YJK5_SCHPO Putative hydroxymethylpyrimidine/phosphomethylpyrimidine kinase C18B5.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18B5.05c PE=3 SV=1 5 266 3.0E-28
sp|O85786|THID_SYNE7 Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Synechococcus elongatus (strain PCC 7942) GN=thiD PE=3 SV=2 18 284 3.0E-27
sp|Q9K9G8|TENA_BACHD Aminopyrimidine aminohydrolase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=tenA PE=1 SV=1 306 507 4.0E-25
sp|Q9ZL00|THID_HELPJ Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=thiD PE=3 SV=1 18 279 5.0E-24
sp|O25515|THID_HELPY Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=thiD PE=3 SV=1 18 279 1.0E-22
sp|Q8CTQ7|PDXK_STAES Putative pyridoxine kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pdxK PE=3 SV=1 1 280 1.0E-20
sp|Q5HI96|PDXK_STAAC Putative pyridoxine kinase OS=Staphylococcus aureus (strain COL) GN=pdxK PE=3 SV=1 1 280 2.0E-20
sp|Q5HRG7|PDXK_STAEQ Putative pyridoxine kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pdxK PE=3 SV=2 1 280 4.0E-20
sp|A8KRL3|TENA_HELPX Aminopyrimidine aminohydrolase OS=Helicobacter pylori GN=tenA PE=1 SV=1 302 507 2.0E-19
sp|O83153|PDXK_TREPA Putative pyridoxine kinase OS=Treponema pallidum (strain Nichols) GN=pdxK PE=3 SV=1 18 266 5.0E-17
sp|Q57688|THIDN_METJA Bifunctional thiamine biosynthesis protein ThiDN OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=thiDN PE=1 SV=2 4 277 2.0E-15
sp|P25052|TENA_BACSU Aminopyrimidine aminohydrolase OS=Bacillus subtilis (strain 168) GN=tenA PE=1 SV=1 301 507 1.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4599
MGRVLLVGGSDCSGGAGLEAGQRVVAAHGCYALTATTALTAQDTKGVWGVHVVPARFVEQQMEACLDDVGADVIV
TGMLASSDTVEAVAAQVQRRGLPVIVDPVVAATAGTELLPPAALQTLLARLLPLTTLLTPNLPEARLILGHDAPV
ESPADLELLARRIQALGPRWVLVKGGHLPLPASACQSAPPTARVVVDVLVGPNAPALHLVSPWQHTSSTHGTGCT
LAAAIAALLARSILHHGHAHLHSDIPPAVRAACRYVEAAIRAAPGFGRGHGPLGHLHSLCLLPFAPGYFVEYLLA
RPDVSPVWHRFLNHPFVHALGHASLPLDSFKGYLVQDYLFLLHFSRAHALAAYKAQTIDDISAAAQTMAQICRET
NLHLSYCHSFGISLSDIKATPEHQACIAYTRYVLDIGHTADALALRMALFPCLLGYAAVAAALDSSPSTLRHDAN
PYWPWIQNYLADDYCRTVESGSRLIEDQMRLQSPSRIQEYINTFIHATRMEIAFWDMFPSS*
Coding >OphauB2|4599
ATGGGACGCGTGTTGCTGGTGGGCGGGTCAGACTGTTCAGGCGGAGCGGGCCTCGAGGCCGGACAGCGCGTGGTG
GCGGCGCATGGCTGCTATGCCCTGACGGCGACGACGGCGCTGACGGCCCAAGACACCAAGGGCGTTTGGGGGGTG
CACGTGGTGCCGGCGCGCTTCGTGGAGCAGCAGATGGAGGCGTGCCTCGACGACGTGGGCGCCGACGTGATTGTC
ACGGGCATGCTGGCATCGTCAGACACAGTCGAGGCCGTGGCAGCCCAGGTGCAGCGGCGCGGCCTGCCCGTCATT
GTCGACCCCGTCGTCGCCGCCACGGCCGGCACGGAGCTGCTCCCCCCCGCCGCCCTGCAGACGCTGCTTGCGCGC
CTCCTCCCCCTGACGACGCTGCTCACGCCCAACCTGCCCGAGGCCCGCCTCATCCTCGGCCACGACGCCCCCGTT
GAGTCGCCCGCCGACTTGGAGCTCCTCGCCCGCCGCATCCAGGCCCTTGGCCCGCGCTGGGTCCTCGTCAAGGGC
GGCCACTTGCCGCTGCCTGCCTCGGCTTGCCAGAGTGCTCCCCCCACCGCCCGCGTCGTCGTCGACGTGCTCGTC
GGCCCCAACGCCCCTGCTCTCCACCTCGTCAGTCCTTGGCAGCACACCTCGAGCACCCACGGCACTGGCTGTACT
CTGGCTGCTGCCATTGCCGCTCTCCTCGCCCGCTCCATCCTCCACCATGGCCACGCCCACTTGCACAGCGACATC
CCCCCCGCCGTCCGCGCTGCCTGCCGCTACGTCGAGGCTGCCATCCGCGCTGCCCCCGGCTTTGGTCGTGGCCAC
GGCCCCTTGGGACACTTGCATTCCCTCTGCCTCCTCCCCTTTGCCCCCGGCTACTTTGTCGAATATCTCCTCGCC
CGTCCCGACGTCAGCCCCGTCTGGCACCGCTTCCTCAATCATCCTTTCGTCCACGCCCTTGGCCACGCCTCCTTG
CCCCTCGACTCCTTCAAGGGCTACCTGGTCCAGGACTATCTCTTCCTTCTTCACTTTTCCCGCGCACACGCTCTC
GCCGCCTACAAGGCCCAGACCATTGACGACATATCCGCTGCCGCCCAAACCATGGCCCAGATTTGCCGTGAAACA
AACTTGCATCTCTCCTATTGTCACTCGTTTGGCATTTCTCTCTCTGACATCAAGGCCACCCCTGAACACCAAGCC
TGCATTGCCTACACCCGCTATGTTCTCGATATTGGCCACACTGCCGACGCTTTAGCCCTCCGCATGGCCCTGTTT
CCCTGTCTGCTCGGCTACGCCGCCGTCGCTGCTGCCCTTGATTCCTCGCCGAGCACCCTTCGCCATGATGCTAAT
CCCTACTGGCCTTGGATTCAGAATTACCTCGCCGACGACTACTGCCGCACCGTTGAATCTGGCTCTCGTCTCATT
GAAGATCAAATGCGCCTACAGTCGCCAAGCCGCATTCAAGAATACATCAATACTTTTATCCACGCTACAAGAATG
GAAATAGCATTTTGGGACATGTTTCCGTCAAGCTGA
Transcript >OphauB2|4599
ATGGGACGCGTGTTGCTGGTGGGCGGGTCAGACTGTTCAGGCGGAGCGGGCCTCGAGGCCGGACAGCGCGTGGTG
GCGGCGCATGGCTGCTATGCCCTGACGGCGACGACGGCGCTGACGGCCCAAGACACCAAGGGCGTTTGGGGGGTG
CACGTGGTGCCGGCGCGCTTCGTGGAGCAGCAGATGGAGGCGTGCCTCGACGACGTGGGCGCCGACGTGATTGTC
ACGGGCATGCTGGCATCGTCAGACACAGTCGAGGCCGTGGCAGCCCAGGTGCAGCGGCGCGGCCTGCCCGTCATT
GTCGACCCCGTCGTCGCCGCCACGGCCGGCACGGAGCTGCTCCCCCCCGCCGCCCTGCAGACGCTGCTTGCGCGC
CTCCTCCCCCTGACGACGCTGCTCACGCCCAACCTGCCCGAGGCCCGCCTCATCCTCGGCCACGACGCCCCCGTT
GAGTCGCCCGCCGACTTGGAGCTCCTCGCCCGCCGCATCCAGGCCCTTGGCCCGCGCTGGGTCCTCGTCAAGGGC
GGCCACTTGCCGCTGCCTGCCTCGGCTTGCCAGAGTGCTCCCCCCACCGCCCGCGTCGTCGTCGACGTGCTCGTC
GGCCCCAACGCCCCTGCTCTCCACCTCGTCAGTCCTTGGCAGCACACCTCGAGCACCCACGGCACTGGCTGTACT
CTGGCTGCTGCCATTGCCGCTCTCCTCGCCCGCTCCATCCTCCACCATGGCCACGCCCACTTGCACAGCGACATC
CCCCCCGCCGTCCGCGCTGCCTGCCGCTACGTCGAGGCTGCCATCCGCGCTGCCCCCGGCTTTGGTCGTGGCCAC
GGCCCCTTGGGACACTTGCATTCCCTCTGCCTCCTCCCCTTTGCCCCCGGCTACTTTGTCGAATATCTCCTCGCC
CGTCCCGACGTCAGCCCCGTCTGGCACCGCTTCCTCAATCATCCTTTCGTCCACGCCCTTGGCCACGCCTCCTTG
CCCCTCGACTCCTTCAAGGGCTACCTGGTCCAGGACTATCTCTTCCTTCTTCACTTTTCCCGCGCACACGCTCTC
GCCGCCTACAAGGCCCAGACCATTGACGACATATCCGCTGCCGCCCAAACCATGGCCCAGATTTGCCGTGAAACA
AACTTGCATCTCTCCTATTGTCACTCGTTTGGCATTTCTCTCTCTGACATCAAGGCCACCCCTGAACACCAAGCC
TGCATTGCCTACACCCGCTATGTTCTCGATATTGGCCACACTGCCGACGCTTTAGCCCTCCGCATGGCCCTGTTT
CCCTGTCTGCTCGGCTACGCCGCCGTCGCTGCTGCCCTTGATTCCTCGCCGAGCACCCTTCGCCATGATGCTAAT
CCCTACTGGCCTTGGATTCAGAATTACCTCGCCGACGACTACTGCCGCACCGTTGAATCTGGCTCTCGTCTCATT
GAAGATCAAATGCGCCTACAGTCGCCAAGCCGCATTCAAGAATACATCAATACTTTTATCCACGCTACAAGAATG
GAAATAGCATTTTGGGACATGTTTCCGTCAAGCTGA
Gene >OphauB2|4599
ATGGGACGCGTGTTGCTGGTGGGCGGGTCAGACTGTTCAGGCGGAGCGTAAGCAGCGCGGCGCGTGTTTGCAAGA
AGCAGCGACAGCTAACAGCGGCAGGGGCCTCGAGGCCGGACAGCGCGTGGTGGCGGCGCATGGCTGCTATGCCCT
GACGGCGACGACGGCGCTGACGGCCCAAGACACCAAGGGCGTTTGGGGGGTGCACGTGGTGCCGGCGCGCTTCGT
GGAGCAGCAGATGGAGGCGTGCCTCGACGACGTGGGCGCCGACGTGATTGTCACGGGTAGTAGTCGTCTCTCTTT
TGCCCTTGGTCTATTCTCCTCCTCTTTGCCCTCTATCCTCCTCTTTGCCCTCTATCCTCTTCGCTTTGCCCTTGC
TCTATTCTCCTTCTCCTCTTGACCTTTGCTCTATTCTCCTCGCTTTTGCCCTTGGTCTATTCTCCTCTTGACCTT
TGCTCTATTCTCCTCGCTTTTGCCCTTGGTCTATTCTCCTCTTGACCCTTGCTCTATCCTCCTTTTAACCCTTGC
TCTATTCTCCTTGCTTTTGCCCTCTATCCTCCTCTTTACCATCTATTCTCCTCTTAACCCTTACTCTATTCTCCT
TTTAACCCTTACTCTATCCTCCTCGCTTTTGCCCTTGGTCTATTCTCCTCTTGACCCTTGCTCTATTCTCCTCGC
TTTTGCCCTCGTCGTCTCATGGCCAAGGACCCAATCTCACCAACCCTCCTCCTCCCCCTCCACCCCCATATATAG
GCATGCTGGCATCGTCAGACACAGTCGAGGCCGTGGCAGCCCAGGTGCAGCGGCGCGGCCTGCCCGTCATTGTCG
ACCCCGTCGTCGCCGCCACGGCCGGCACGGAGCTGCTCCCCCCCGCCGCCCTGCAGACGCTGCTTGCGCGCCTCC
TCCCCCTGACGACGCTGCTCACGCCCAACCTGCCCGAGGCCCGCCTCATCCTCGGCCACGACGCCCCCGTTGAGT
CGCCCGCCGACTTGGAGCTCCTCGCCCGCCGCATCCAGGCCCTTGGCCCGCGCTGGGTCCTCGTCAAGGGCGGCC
ACTTGCCGCTGCCTGCCTCGGCTTGCCAGAGTGCTCCCCCCACCGCCCGCGTCGTCGTCGACGTGCTCGTCGGCC
CCAACGCCCCTGCTCTCCACCTCGTCAGTCCTTGGCAGCACACCTCGAGCACCCACGGCACTGGCTGTACTCTGG
CTGCTGCCATTGCCGCTCTCCTCGCCCGCTCCATCCTCCACCATGGCCACGCCCACTTGCACAGCGACATCCCCC
CCGCCGTCCGCGCTGCCTGCCGCTACGTCGAGGCTGCCATCCGCGCTGCCCCCGGCTTTGGTCGTGGCCACGGCC
CCTTGGGACACTTGCATTCCCTCTGCCTCCTCCCCTTTGCCCCGTGAGCCCTCTCCACCTCCCCTGCTGTCCCAG
AGCAAGACTCACCTCTGTCTTTGAAGCGGCTACTTTGTCGAATATCTCCTCGCCCGTCCCGACGTCAGCCCCGTC
TGGCACCGCTTCCTCAATCATCCTTTCGTCCACGCCCTTGGCCACGCCTCCTTGCCCCTCGACTCCTTCAAGGGC
TACCTGGTCCAGGACTATCTCTTCCTTGTTTGTTGCTCTTACCACACACCCTGTCCTGACCAGCCCCTGCTCATG
CCCCAGCCATGTAGCTTCACTTTTCCCGCGCACACGCTCTCGCCGCCTACAAGGCCCAGACCATTGACGACATAT
CCGCTGTATCCGCCTCTCCATCTGTCCCCCTGCCAGAAACTTCCCGCTGATTCTTGTCTGTCTAGGCCGCCCAAA
CCATGGCCCAGATTTGCCGTGAAACAAACTTGCATCTCTCCTATTGTCACTCGTTTGGCATTTCTCTCTCTGACA
TCAAGGCCACCCCTGAACACCAAGGTAATCCCCTCTTGTCGCCTTGTCCTTCTTTTTTCGAGGGGGAGCGGCAGC
GGCACCAAGGGGAAAAAAAGAGGACTGACCCCGTCTTAGCCTGCATTGCCTACACCCGCTATGTTCTCGATATTG
GCCACACTGCCGACGCTTTAGCCCTCCGCATGGCCCTGTTTCCCTGTCTGCTCGGCTACGCCGCCGTCGCTGCTG
CCCTTGATTCCTCGCCGAGCACCCTTCGCCATGATGCTAATCCCTACTGGCCTTGGATTCAGAATTACCTCGCCG
ACGACTACTGCCGCACCGTTGAATCTGGCTCTCGTAAGTGTTTTTGTTTCATCGCTCTCTCAACTCTACTCTTCT
CCTTCTCTATCCTTCCCTCGCCTGACTCGCCCCCTTTCTAGGTCTCATTGAAGATCAAATGCGCCTACAGTCGCC
AAGCCGCATTCAAGAATACATCAATACTTTTATCCACGCTACAAGAGTAAGTCGCCCCCCCCCCCCCAAACTCTC
TTTCAAGATGTCAAAAATCAGTCTTCATCCCTCTCTCCCTACATCTTCAGCATCACAGCTGATTAGGTTCGCCGT
CCTGACAAATTCCAATAGATGGAAATAGCATTTTGGGACATGTTTCCGTCAAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail