Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4597
Gene name
LocationContig_308:4675..6736
Strand-
Gene length (bp)2061
Transcript length (bp)1704
Coding sequence length (bp)1704
Protein length (aa) 568

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04928 PAP_central Poly(A) polymerase central domain 5.9E-110 8 356
PF04926 PAP_RNA-bind Poly(A) polymerase predicted RNA binding domain 5.8E-64 358 533
PF01909 NTP_transf_2 Nucleotidyltransferase domain 1.1E-08 82 165

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10295|PAP_SCHPO Poly(A) polymerase pla1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pla1 PE=1 SV=1 8 538 0.0E+00
sp|P29468|PAP_YEAST Poly(A) polymerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAP1 PE=1 SV=1 1 566 1.0E-170
sp|Q9UW26|PAPA_CANAL Poly(A) polymerase PAPa OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAPA PE=3 SV=1 4 545 7.0E-167
sp|O42617|PAP_CANAL Poly(A) polymerase PAPalpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAPALPHA PE=3 SV=1 5 556 8.0E-164
sp|Q9BWT3|PAPOG_HUMAN Poly(A) polymerase gamma OS=Homo sapiens GN=PAPOLG PE=1 SV=2 8 408 1.0E-120
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10295|PAP_SCHPO Poly(A) polymerase pla1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pla1 PE=1 SV=1 8 538 0.0E+00
sp|P29468|PAP_YEAST Poly(A) polymerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAP1 PE=1 SV=1 1 566 1.0E-170
sp|Q9UW26|PAPA_CANAL Poly(A) polymerase PAPa OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAPA PE=3 SV=1 4 545 7.0E-167
sp|O42617|PAP_CANAL Poly(A) polymerase PAPalpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAPALPHA PE=3 SV=1 5 556 8.0E-164
sp|Q9BWT3|PAPOG_HUMAN Poly(A) polymerase gamma OS=Homo sapiens GN=PAPOLG PE=1 SV=2 8 408 1.0E-120
sp|Q6PCL9|PAPOG_MOUSE Poly(A) polymerase gamma OS=Mus musculus GN=Papolg PE=1 SV=1 8 408 1.0E-120
sp|Q54J73|PAP_DICDI Poly(A) polymerase OS=Dictyostelium discoideum GN=papA PE=3 SV=1 8 565 8.0E-118
sp|Q9NRJ5|PAPOB_HUMAN Poly(A) polymerase beta OS=Homo sapiens GN=PAPOLB PE=2 SV=1 8 408 1.0E-110
sp|Q61183|PAPOA_MOUSE Poly(A) polymerase alpha OS=Mus musculus GN=Papola PE=1 SV=4 2 408 4.0E-109
sp|Q9WVP6|PAPOB_MOUSE Poly(A) polymerase beta OS=Mus musculus GN=Papolb PE=1 SV=2 2 408 8.0E-109
sp|P51003|PAPOA_HUMAN Poly(A) polymerase alpha OS=Homo sapiens GN=PAPOLA PE=1 SV=4 2 408 8.0E-109
sp|P25500|PAPOA_BOVIN Poly(A) polymerase alpha OS=Bos taurus GN=PAPOLA PE=1 SV=3 2 408 1.0E-108
sp|P51004|PAPO1_XENLA Poly(A) polymerase alpha-A (Fragment) OS=Xenopus laevis GN=papola-a PE=2 SV=1 5 408 6.0E-107
sp|Q8VYW1|PAPS4_ARATH Nuclear poly(A) polymerase 4 OS=Arabidopsis thaliana GN=PAPS4 PE=1 SV=1 8 546 1.0E-102
sp|Q9LMT2|PAPS1_ARATH Nuclear poly(A) polymerase 1 OS=Arabidopsis thaliana GN=PAPS1 PE=1 SV=1 5 543 1.0E-101
sp|O82312|PAPS2_ARATH Nuclear poly(A) polymerase 2 OS=Arabidopsis thaliana GN=PAPS2 PE=1 SV=2 8 533 1.0E-101
sp|P51006|PAPO3_XENLA Poly(A) polymerase type 3 (Fragment) OS=Xenopus laevis PE=2 SV=1 5 366 3.0E-99
sp|Q56XM9|PAPS3_ARATH Nuclear poly(A) polymerase 3 OS=Arabidopsis thaliana GN=PAPS3 PE=1 SV=1 25 399 1.0E-49
sp|P51005|PAPO2_XENLA Poly(A) polymerase alpha-B OS=Xenopus laevis GN=papola-b PE=2 SV=1 243 408 7.0E-43
sp|Q51D88|PAP_ENTHI Poly(A) polymerase OS=Entamoeba histolytica GN=16.t00038 PE=2 SV=1 85 414 9.0E-39
[Show less]

GO

GO Term Description Terminal node
GO:0043631 RNA polyadenylation Yes
GO:0004652 polynucleotide adenylyltransferase activity Yes
GO:0003723 RNA binding Yes
GO:0016779 nucleotidyltransferase activity Yes
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0070566 adenylyltransferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003824 catalytic activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0003676 nucleic acid binding No
GO:0016740 transferase activity No
GO:0046483 heterocycle metabolic process No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4597
MPGDQTCGVTPPLSSTLPTEGEKRVSEALIEELRRQKTFENPSDTQKRHKVLDSLQTICDEFVKHVAKSKEPNND
ILIKNARGKVFTYGSFRLGVFGPGSDIDTLIVAPKYVTRDDYFEHFPKMLVEMAPKNAITNLTVVTEAFVPIIKF
EFTDISIDLIFSRIIQKQLSPDLHDLKDSSLLRGLDEPELRSLNGTRVTDEILNLVPEPSTFKLALRAIKLWAQR
RAVYANIMGFPGGVAWAMLVARVCQLYPKAATSVIVNKFFLVMAKWPWPHPVLLKPIENGPLPVRVWNPKVYKGD
SFHLMPVITPAYPSMCSTFNITRSSMTIITRELQRGLELTEAIMMGKRPWSDLFVKHTFFTADYRYYISVTTASK
DKEAHKIWSGYVESKVRMLVQKLELHQSIKLAHPFNKGYDRRHRCQSSDDVARVQEGCLDFLVKSDNVETAEIKE
SEEQQGTSPIDVFTTTHYIGLQLEDKAKALDLSYQVDEFKSLCTQWKKYQDDLEPLVSIGIQHVRNINLPDDVFD
EGEKKPQRKGATASLNAKKRGPQEENSQPPAKRPQHSVAAAC*
Coding >OphauB2|4597
ATGCCTGGTGATCAGACTTGTGGCGTCACGCCACCCCTGTCCAGCACTCTTCCTACTGAAGGCGAGAAGCGAGTC
AGCGAGGCACTCATTGAAGAGCTGCGTCGGCAAAAAACCTTTGAGAACCCCTCCGATACCCAAAAGCGTCACAAG
GTTCTCGATTCTCTTCAAACCATATGCGACGAGTTCGTCAAGCACGTGGCCAAGTCCAAGGAGCCCAACAACGAT
ATTCTCATCAAGAATGCCCGCGGCAAGGTCTTCACCTACGGTAGCTTTCGTCTTGGTGTCTTTGGCCCCGGATCT
GACATTGACACTCTCATTGTCGCACCAAAATACGTCACCAGAGACGACTATTTTGAGCATTTCCCAAAGATGCTC
GTCGAAATGGCCCCCAAGAATGCCATTACCAATCTGACTGTTGTCACCGAAGCCTTTGTTCCAATCATAAAATTT
GAGTTTACCGATATCAGCATCGACCTCATTTTCTCGCGCATCATACAGAAGCAACTTTCTCCGGACTTGCACGAC
CTCAAAGACTCGTCCCTACTTCGTGGTCTTGACGAGCCCGAACTGCGCTCCTTGAACGGCACGCGCGTAACTGAC
GAGATTCTCAATCTTGTTCCTGAGCCCAGCACTTTCAAGCTTGCGCTTCGGGCAATAAAGCTTTGGGCTCAGCGC
CGCGCCGTGTATGCCAATATCATGGGATTTCCTGGTGGCGTTGCCTGGGCCATGCTCGTCGCCCGTGTTTGTCAG
CTTTATCCCAAAGCTGCAACATCTGTCATCGTAAATAAGTTTTTTCTCGTCATGGCTAAGTGGCCATGGCCTCAT
CCTGTCCTTCTTAAGCCCATAGAGAACGGACCTCTTCCTGTCCGAGTTTGGAATCCCAAGGTCTACAAGGGAGAT
TCATTTCATTTAATGCCTGTCATTACGCCAGCTTACCCATCCATGTGCTCCACTTTCAACATCACGCGTTCTTCA
ATGACCATCATTACCCGAGAACTCCAGCGTGGACTGGAGCTAACTGAGGCCATCATGATGGGGAAGAGACCCTGG
AGCGATCTTTTTGTCAAACACACCTTTTTTACAGCCGATTATAGATATTATATCTCCGTCACTACCGCCAGCAAG
GATAAGGAAGCCCATAAAATATGGTCGGGCTATGTCGAATCCAAGGTCCGAATGCTAGTTCAAAAACTCGAATTG
CACCAATCCATAAAGCTGGCACATCCATTCAACAAAGGTTACGACCGCCGTCACCGCTGCCAAAGCAGTGACGAC
GTGGCACGGGTACAAGAAGGTTGTCTTGACTTTCTTGTCAAGTCTGACAATGTAGAGACAGCTGAGATCAAGGAA
AGCGAAGAGCAGCAAGGCACCTCTCCAATCGACGTCTTTACGACGACCCACTATATTGGTCTGCAACTCGAGGAC
AAGGCTAAAGCACTTGATCTATCCTACCAGGTAGACGAATTTAAGTCTTTGTGTACGCAGTGGAAGAAGTATCAA
GATGATTTGGAGCCTTTGGTTTCAATTGGCATCCAGCACGTGCGAAACATAAATCTCCCCGATGACGTTTTCGAC
GAGGGCGAAAAGAAGCCTCAGAGGAAGGGCGCTACCGCGTCCCTTAATGCCAAGAAGCGTGGCCCACAAGAGGAA
AACTCTCAACCGCCCGCAAAACGACCTCAACATTCGGTGGCAGCCGCGTGTTAA
Transcript >OphauB2|4597
ATGCCTGGTGATCAGACTTGTGGCGTCACGCCACCCCTGTCCAGCACTCTTCCTACTGAAGGCGAGAAGCGAGTC
AGCGAGGCACTCATTGAAGAGCTGCGTCGGCAAAAAACCTTTGAGAACCCCTCCGATACCCAAAAGCGTCACAAG
GTTCTCGATTCTCTTCAAACCATATGCGACGAGTTCGTCAAGCACGTGGCCAAGTCCAAGGAGCCCAACAACGAT
ATTCTCATCAAGAATGCCCGCGGCAAGGTCTTCACCTACGGTAGCTTTCGTCTTGGTGTCTTTGGCCCCGGATCT
GACATTGACACTCTCATTGTCGCACCAAAATACGTCACCAGAGACGACTATTTTGAGCATTTCCCAAAGATGCTC
GTCGAAATGGCCCCCAAGAATGCCATTACCAATCTGACTGTTGTCACCGAAGCCTTTGTTCCAATCATAAAATTT
GAGTTTACCGATATCAGCATCGACCTCATTTTCTCGCGCATCATACAGAAGCAACTTTCTCCGGACTTGCACGAC
CTCAAAGACTCGTCCCTACTTCGTGGTCTTGACGAGCCCGAACTGCGCTCCTTGAACGGCACGCGCGTAACTGAC
GAGATTCTCAATCTTGTTCCTGAGCCCAGCACTTTCAAGCTTGCGCTTCGGGCAATAAAGCTTTGGGCTCAGCGC
CGCGCCGTGTATGCCAATATCATGGGATTTCCTGGTGGCGTTGCCTGGGCCATGCTCGTCGCCCGTGTTTGTCAG
CTTTATCCCAAAGCTGCAACATCTGTCATCGTAAATAAGTTTTTTCTCGTCATGGCTAAGTGGCCATGGCCTCAT
CCTGTCCTTCTTAAGCCCATAGAGAACGGACCTCTTCCTGTCCGAGTTTGGAATCCCAAGGTCTACAAGGGAGAT
TCATTTCATTTAATGCCTGTCATTACGCCAGCTTACCCATCCATGTGCTCCACTTTCAACATCACGCGTTCTTCA
ATGACCATCATTACCCGAGAACTCCAGCGTGGACTGGAGCTAACTGAGGCCATCATGATGGGGAAGAGACCCTGG
AGCGATCTTTTTGTCAAACACACCTTTTTTACAGCCGATTATAGATATTATATCTCCGTCACTACCGCCAGCAAG
GATAAGGAAGCCCATAAAATATGGTCGGGCTATGTCGAATCCAAGGTCCGAATGCTAGTTCAAAAACTCGAATTG
CACCAATCCATAAAGCTGGCACATCCATTCAACAAAGGTTACGACCGCCGTCACCGCTGCCAAAGCAGTGACGAC
GTGGCACGGGTACAAGAAGGTTGTCTTGACTTTCTTGTCAAGTCTGACAATGTAGAGACAGCTGAGATCAAGGAA
AGCGAAGAGCAGCAAGGCACCTCTCCAATCGACGTCTTTACGACGACCCACTATATTGGTCTGCAACTCGAGGAC
AAGGCTAAAGCACTTGATCTATCCTACCAGGTAGACGAATTTAAGTCTTTGTGTACGCAGTGGAAGAAGTATCAA
GATGATTTGGAGCCTTTGGTTTCAATTGGCATCCAGCACGTGCGAAACATAAATCTCCCCGATGACGTTTTCGAC
GAGGGCGAAAAGAAGCCTCAGAGGAAGGGCGCTACCGCGTCCCTTAATGCCAAGAAGCGTGGCCCACAAGAGGAA
AACTCTCAACCGCCCGCAAAACGACCTCAACATTCGGTGGCAGCCGCGTGTTAA
Gene >OphauB2|4597
ATGCCTGGTGATCAGACTTGTGGCGTCACGCCACCCCTGTCCAGCACTCTTCCTACTGAAGGCGAGAAGCGAGTC
AGCGAGGCACTCATTGAAGAGCTGCGTCGGCAAAAAACCTTTGAGAACCCCTCCGATACCCAAAAGCGGTGCGTT
TATTTGCTCCAAGATACAAGCGCAATGCGTTTAATAAACTAACTCCGCTTGTCTACAGTCACAAGGTTCTCGATT
CTCTTCAAACCATATGCGACGAGTTCGTCAAGCACGTGGCCAAGTCCAAGGAGCCCAACAACGATATTCTCATCA
AGAATGCCCGCGGCAAGGTCTTCACCTACGGTAGCTTTCGTCTTGGTGTCTTTGGCCCCGGATCTGACATTGACA
CTCTCATTGTCGCACCAAAATACGTCACCAGAGACGACTATTTTGAGCATTTCCCAAAGATGCTCGTCGAAATGG
CCCCCAAGAATGCCATTACCAATCTGACTGTTGTCACCGAAGCCTTTGTTCCAATCATAAAATTTGAGTTTACCG
ATATCAGCATCGACCTCATTTTCTCGCGCATCATACAGAAGCAACTTTCTCCGGACTTGCACGACCTCAAAGACT
CGTCCCTACTTCGTGGTCTTGACGAGCCCGAACTGCGCTCCTTGAACGGCACGCGCGTAACTGACGAGATTCTCA
ATCTTGTTCCTGAGCCCAGCACTTTCAAGCTTGCGCTTCGGGCAATAAAGCTTTGGGCTCAGCGCCGCGCCGTGT
ATGCCAATATCATGGGATTTCCTGGTGGCGTTGCCTGGGCCATGCTCGTCGCCCGTGTTTGTCAGCTTTATCCCA
AAGCTGCAACATCTGTCATCGTAAATAAGTTTTTTCTCGTCATGGCTAAGTGGCCATGGCCTCATCCTGTCCTTC
TTAAGCCCATAGAGAACGGACCTCTTCCTGTCCGAGTTTGGAATCCCAAGGTTTGTCTTTTTGGTTTATGACGCT
CCTAACTTCTGTTTGGCCTATGAATAACAATTCCACTAGGTCTACAAGGGAGATTCATTTCATTTAATGCCTGTC
ATTACGCCAGCTTACCCATCCATGTGCTCCACTTTCAACATCACGCGTTCTTCAATGACCATCATTACCCGAGAA
CTCCAGCGTGGACTGGAGCTAACTGAGGCCATCATGATGGGGAAGAGACCCTGGAGCGATCTTTTTGTCAAACAC
ACCTTTTTTACAGCCGATTATAGATATTATATCTCCGTCACTACCGCCAGCAAGGATAAGGAAGCCCATAAAATA
TGGTCGGGCTATGTCGAATCCAAGGTCCGAATGCTAGTTCAAAAACTCGAATTGCACCAATCCATAAAGCTGGCA
CATCCATTCAACAAAGGTTACGACCGCCGTCACCGCTGCCAAAGCAGTGACGACGTGGCACGGGTACAAGAAGGT
TGTCTTGACTTTCTTGTCAAGTCTGACAATGTAGAGACAGCTGAGATCAAGGAAAGCGAAGAGCAGCAAGGCACC
TCTCCAATCGACGTCTTTACGACGACCCACTATATTGGTCTGCAACTCGAGGACAGTAAGTCAAAAATCCCTGCC
TGGGGCCATGCCGGAACAGAAAGCCACGACATGGATTTCCATGCCGCGACGCGACAAGCTGACTTTTTTGTATTA
AAAGAGGCTAAAGCACTTGATCTATCCTACCAGGTAGACGAATTTAAGTCTTTGTGTACGCAGTGGAAGAAGTAT
CAAGATGATTTGGAGCCTTTGGTTTCAATTGGCATCCAGCACGTGCGAAAGTGAGTCGACATCAAAACCTTTCGG
GTTCATTTCGCAGATGGAAGACTCATAAAACCATGATGTGCCCTCAGCATAAATCTCCCCGATGACGTTTTCGAC
GAGGGCGAAAAGAAGCCTCAGAGGAAGGGCGCTACCGCGTCCCTTAATGCCAAGAAGCGTGGCCCACAAGAGGTG
ACATTGATGGTTCCAATGTACTCACAAGAGACTAATCATCTGACACGCACTCAGGAAAACTCTCAACCGCCCGCA
AAACGACCTCAACATTCGGTGGCAGCCGCGTGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail