Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4589
Gene name
LocationContig_305:6331..7595
Strand+
Gene length (bp)1264
Transcript length (bp)711
Coding sequence length (bp)711
Protein length (aa) 237

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 3.0E-11 11 57
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 2.3E-08 67 105
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 1.2E-11 14 72

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13493|MYB1_NEUCR Myb-like DNA-binding protein myb-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rca-1 PE=3 SV=2 9 119 2.0E-35
sp|Q9FDW1|MYB44_ARATH Transcription factor MYB44 OS=Arabidopsis thaliana GN=MYB44 PE=2 SV=1 11 185 1.0E-22
sp|P52550|MYBA_CHICK Myb-related protein A OS=Gallus gallus GN=MYBL1 PE=2 SV=1 11 148 2.0E-21
sp|P10242|MYB_HUMAN Transcriptional activator Myb OS=Homo sapiens GN=MYB PE=1 SV=2 11 137 3.0E-21
sp|P46200|MYB_BOVIN Transcriptional activator Myb OS=Bos taurus GN=MYB PE=2 SV=1 11 137 4.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13493|MYB1_NEUCR Myb-like DNA-binding protein myb-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rca-1 PE=3 SV=2 9 119 2.0E-35
sp|Q9FDW1|MYB44_ARATH Transcription factor MYB44 OS=Arabidopsis thaliana GN=MYB44 PE=2 SV=1 11 185 1.0E-22
sp|P52550|MYBA_CHICK Myb-related protein A OS=Gallus gallus GN=MYBL1 PE=2 SV=1 11 148 2.0E-21
sp|P10242|MYB_HUMAN Transcriptional activator Myb OS=Homo sapiens GN=MYB PE=1 SV=2 11 137 3.0E-21
sp|P46200|MYB_BOVIN Transcriptional activator Myb OS=Bos taurus GN=MYB PE=2 SV=1 11 137 4.0E-21
sp|P01103|MYB_CHICK Transcriptional activator Myb OS=Gallus gallus GN=MYB PE=1 SV=1 11 134 1.0E-20
sp|Q08759|MYB_XENLA Transcriptional activator Myb OS=Xenopus laevis GN=myb PE=2 SV=1 11 135 2.0E-20
sp|P06876|MYB_MOUSE Transcriptional activator Myb OS=Mus musculus GN=Myb PE=1 SV=2 11 137 3.0E-20
sp|Q0JIC2|GAM1_ORYSJ Transcription factor GAMYB OS=Oryza sativa subsp. japonica GN=GAM1 PE=2 SV=1 10 116 5.0E-20
sp|A2WW87|GAM1_ORYSI Transcription factor GAMYB OS=Oryza sativa subsp. indica GN=GAM1 PE=2 SV=1 10 116 5.0E-20
sp|P01104|MYB_AVIMB Transforming protein Myb OS=Avian myeloblastosis virus GN=V-MYB PE=1 SV=2 11 134 7.0E-20
sp|P04197|MYB_DROME Myb protein OS=Drosophila melanogaster GN=Myb PE=1 SV=2 11 120 2.0E-19
sp|Q9S7G7|MB3R1_ARATH Myb-related protein 3R-1 OS=Arabidopsis thaliana GN=MYB3R-1 PE=2 SV=1 11 105 2.0E-19
sp|Q05935|MYBA_XENLA Myb-related protein A OS=Xenopus laevis GN=mybl1 PE=2 SV=1 11 123 4.0E-19
sp|P52551|MYBB_XENLA Myb-related protein B OS=Xenopus laevis GN=mybl2 PE=2 SV=2 11 123 6.0E-19
sp|P10244|MYBB_HUMAN Myb-related protein B OS=Homo sapiens GN=MYBL2 PE=1 SV=1 11 110 7.0E-19
sp|P51960|MYBA_MOUSE Myb-related protein A OS=Mus musculus GN=Mybl1 PE=1 SV=2 11 123 7.0E-19
sp|P10243|MYBA_HUMAN Myb-related protein A OS=Homo sapiens GN=MYBL1 PE=1 SV=2 11 123 7.0E-19
sp|P48972|MYBB_MOUSE Myb-related protein B OS=Mus musculus GN=Mybl2 PE=1 SV=1 11 110 8.0E-19
sp|Q03237|MYBB_CHICK Myb-related protein B OS=Gallus gallus GN=MYBL2 PE=1 SV=1 11 110 1.0E-18
sp|P34127|MYBA_DICDI Myb-like protein A OS=Dictyostelium discoideum GN=mybA PE=3 SV=2 11 129 3.0E-18
sp|Q9S7L2|MYB98_ARATH Transcription factor MYB98 OS=Arabidopsis thaliana GN=MYB98 PE=2 SV=1 11 123 4.0E-18
sp|P81396|MYB40_ANTMA Myb-related protein 340 OS=Antirrhinum majus GN=MYB340 PE=2 SV=1 10 176 5.0E-18
sp|Q9SJL7|RAX2_ARATH Transcription factor RAX2 OS=Arabidopsis thaliana GN=RAX2 PE=1 SV=1 10 105 1.0E-17
sp|Q9LK95|MYB21_ARATH Transcription factor MYB21 OS=Arabidopsis thaliana GN=MYB21 PE=1 SV=1 10 137 3.0E-17
sp|Q9SEI0|WER_ARATH Transcription factor WER OS=Arabidopsis thaliana GN=WER PE=1 SV=1 9 105 4.0E-17
sp|P81394|MYB15_ANTMA Myb-related protein 315 OS=Antirrhinum majus GN=MYB315 PE=2 SV=1 10 105 5.0E-17
sp|Q9SSA1|MYB57_ARATH Transcription factor MYB57 OS=Arabidopsis thaliana GN=MYB57 PE=2 SV=1 10 130 6.0E-17
sp|Q9LSI7|MYB35_ARATH Transcription factor MYB35 OS=Arabidopsis thaliana GN=MYB35 PE=2 SV=1 10 105 8.0E-17
sp|Q9SPG9|MYB24_ARATH Transcription factor MYB24 OS=Arabidopsis thaliana GN=MYB24 PE=1 SV=1 10 104 1.0E-16
sp|P27900|GL1_ARATH Trichome differentiation protein GL1 OS=Arabidopsis thaliana GN=GL1 PE=1 SV=2 9 105 2.0E-16
sp|Q96276|MYB23_ARATH Transcription factor MYB23 OS=Arabidopsis thaliana GN=MYB23 PE=1 SV=1 9 105 2.0E-16
sp|Q9LTF7|MYB82_ARATH Transcription factor MYB82 OS=Arabidopsis thaliana GN=MYB82 PE=1 SV=1 10 119 2.0E-16
sp|Q9FG68|RAX1_ARATH Transcription factor RAX1 OS=Arabidopsis thaliana GN=RAX1 PE=2 SV=1 10 105 3.0E-16
sp|Q947R4|GL1_ARALY Trichome differentiation protein GL1 OS=Arabidopsis lyrata GN=GL1 PE=3 SV=2 9 105 3.0E-16
sp|Q54HP1|MYBQ_DICDI Myb-like protein Q OS=Dictyostelium discoideum GN=mybQ PE=3 SV=1 11 105 1.0E-15
sp|P81391|MYB05_ANTMA Myb-related protein 305 OS=Antirrhinum majus GN=MYB305 PE=2 SV=1 10 180 2.0E-15
sp|P10290|MYBC_MAIZE Anthocyanin regulatory C1 protein OS=Zea mays GN=C1 PE=2 SV=1 10 105 3.0E-15
sp|O49608|MYB32_ARATH Transcription factor MYB32 OS=Arabidopsis thaliana GN=MYB32 PE=2 SV=1 8 163 6.0E-15
sp|Q4JL84|MYB59_ARATH Transcription factor MYB59 OS=Arabidopsis thaliana GN=MYB59 PE=2 SV=2 8 117 7.0E-15
sp|Q9LXV2|MYB46_ARATH Transcription factor MYB46 OS=Arabidopsis thaliana GN=MYB46 PE=2 SV=1 1 113 8.0E-15
sp|Q9SPG3|MYB26_ARATH Transcription factor MYB26 OS=Arabidopsis thaliana GN=MYB26 PE=2 SV=1 10 105 1.0E-14
sp|Q9LX82|MYB48_ARATH Transcription factor MYB48 OS=Arabidopsis thaliana GN=MYB48 PE=2 SV=1 9 117 1.0E-14
sp|Q53NK6|MYBA1_ORYSJ Myb-related protein MYBAS1 OS=Oryza sativa subsp. japonica GN=MYBAS1 PE=2 SV=1 10 177 1.0E-14
sp|Q9SPG2|MYB28_ARATH Transcription factor MYB28 OS=Arabidopsis thaliana GN=MYB28 PE=1 SV=1 10 105 1.0E-14
sp|Q9SM27|MY104_ARATH Transcription factor MYB104 OS=Arabidopsis thaliana GN=MYB104 PE=2 SV=3 11 112 2.0E-14
sp|Q8GWP0|MYB39_ARATH Transcription factor MYB39 OS=Arabidopsis thaliana GN=MYB39 PE=2 SV=1 10 105 2.0E-14
sp|Q9SPG5|MYB76_ARATH Transcription factor MYB76 OS=Arabidopsis thaliana GN=MYB76 PE=1 SV=1 10 105 2.0E-14
sp|P81392|MYB06_ANTMA Myb-related protein 306 OS=Antirrhinum majus GN=MYB306 PE=2 SV=1 10 105 3.0E-14
sp|Q9M2Y9|RAX3_ARATH Transcription factor RAX3 OS=Arabidopsis thaliana GN=RAX3 PE=2 SV=1 10 113 3.0E-14
sp|Q38850|MYB5_ARATH Transcription repressor MYB5 OS=Arabidopsis thaliana GN=MYB5 PE=1 SV=1 7 105 7.0E-14
sp|Q9FLR1|MYB29_ARATH Transcription factor MYB29 OS=Arabidopsis thaliana GN=MYB29 PE=1 SV=1 10 105 8.0E-14
sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 8 105 8.0E-14
sp|P20024|MYB1_MAIZE Myb-related protein Zm1 OS=Zea mays PE=2 SV=1 11 133 8.0E-14
sp|B0G0Y5|MYBAA_DICDI Myb-like protein AA OS=Dictyostelium discoideum GN=mybAA PE=3 SV=1 11 110 8.0E-14
sp|O64399|MYB34_ARATH Transcription factor MYB34 OS=Arabidopsis thaliana GN=MYB34 PE=1 SV=1 10 126 1.0E-13
sp|P20025|MYB38_MAIZE Myb-related protein Zm38 OS=Zea mays PE=2 SV=1 8 105 1.0E-13
sp|P81395|MYB30_ANTMA Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1 8 105 2.0E-13
sp|Q9SCU7|MYB30_ARATH Transcription factor MYB30 OS=Arabidopsis thaliana GN=MYB30 PE=1 SV=1 10 105 2.0E-13
sp|Q9LDE1|MY108_ARATH Transcription factor MYB108 OS=Arabidopsis thaliana GN=MYB108 PE=1 SV=1 10 104 2.0E-13
sp|P27898|MYBP_MAIZE Myb-related protein P OS=Zea mays GN=P PE=2 SV=1 10 122 2.0E-13
sp|Q9M0K4|LAF1_ARATH Transcription factor LAF1 OS=Arabidopsis thaliana GN=LAF1 PE=1 SV=2 9 104 2.0E-13
sp|Q50EX6|ODO1_PETHY Protein ODORANT1 OS=Petunia hybrida GN=ODO1 PE=2 SV=1 7 105 2.0E-13
sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 8 131 2.0E-13
sp|Q9FJA2|TT2_ARATH Transcription factor TT2 OS=Arabidopsis thaliana GN=TT2 PE=1 SV=1 11 118 2.0E-13
sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 8 105 2.0E-13
sp|O22264|MYB12_ARATH Transcription factor MYB12 OS=Arabidopsis thaliana GN=MYB12 PE=2 SV=1 10 105 4.0E-13
sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 8 105 5.0E-13
sp|Q4JL76|MYBA2_ORYSJ Myb-related protein MYBAS2 OS=Oryza sativa subsp. japonica GN=MYBAS2 PE=2 SV=1 10 118 6.0E-13
sp|P80073|MYB2_PHYPA Myb-related protein Pp2 OS=Physcomitrella patens subsp. patens GN=PP2 PE=2 SV=1 10 115 7.0E-13
sp|Q8LPH6|MYB86_ARATH Transcription factor MYB86 OS=Arabidopsis thaliana GN=MYB86 PE=2 SV=1 10 119 1.0E-12
sp|Q9FNV9|MY113_ARATH Transcription factor MYB113 OS=Arabidopsis thaliana GN=MYB113 PE=1 SV=1 10 188 2.0E-12
sp|P51960|MYBA_MOUSE Myb-related protein A OS=Mus musculus GN=Mybl1 PE=1 SV=2 11 143 3.0E-12
sp|P20027|MYB3_HORVU Myb-related protein Hv33 OS=Hordeum vulgare GN=MYB2 PE=2 SV=3 10 115 3.0E-12
sp|P10243|MYBA_HUMAN Myb-related protein A OS=Homo sapiens GN=MYBL1 PE=1 SV=2 11 143 4.0E-12
sp|P20026|MYB1_HORVU Myb-related protein Hv1 OS=Hordeum vulgare GN=MYB1 PE=2 SV=1 8 135 5.0E-12
sp|P52550|MYBA_CHICK Myb-related protein A OS=Gallus gallus GN=MYBL1 PE=2 SV=1 11 143 7.0E-12
sp|Q54NA6|MYBL_DICDI Myb-like protein L OS=Dictyostelium discoideum GN=mybL PE=3 SV=1 10 117 1.0E-11
sp|O49782|MYB51_ARATH Transcription factor MYB51 OS=Arabidopsis thaliana GN=MYB51 PE=1 SV=2 7 145 1.0E-11
sp|P10242|MYB_HUMAN Transcriptional activator Myb OS=Homo sapiens GN=MYB PE=1 SV=2 8 143 2.0E-11
sp|P46200|MYB_BOVIN Transcriptional activator Myb OS=Bos taurus GN=MYB PE=2 SV=1 8 143 2.0E-11
sp|P01103|MYB_CHICK Transcriptional activator Myb OS=Gallus gallus GN=MYB PE=1 SV=1 8 143 2.0E-11
sp|P06876|MYB_MOUSE Transcriptional activator Myb OS=Mus musculus GN=Myb PE=1 SV=2 8 143 2.0E-11
sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 10 104 3.0E-10
sp|Q8BP86|SNPC4_MOUSE snRNA-activating protein complex subunit 4 OS=Mus musculus GN=Snapc4 PE=1 SV=2 10 119 3.0E-10
sp|Q08759|MYB_XENLA Transcriptional activator Myb OS=Xenopus laevis GN=myb PE=2 SV=1 8 143 4.0E-10
sp|P34127|MYBA_DICDI Myb-like protein A OS=Dictyostelium discoideum GN=mybA PE=3 SV=2 14 104 1.0E-09
sp|Q9FE25|MYB75_ARATH Transcription factor MYB75 OS=Arabidopsis thaliana GN=MYB75 PE=1 SV=1 10 105 1.0E-09
sp|Q9FNV8|MY114_ARATH Transcription factor MYB114 OS=Arabidopsis thaliana GN=MYB114 PE=1 SV=1 10 105 1.0E-09
sp|Q05935|MYBA_XENLA Myb-related protein A OS=Xenopus laevis GN=mybl1 PE=2 SV=1 14 143 2.0E-09
sp|P10244|MYBB_HUMAN Myb-related protein B OS=Homo sapiens GN=MYBL2 PE=1 SV=1 14 169 3.0E-09
sp|M1ETA5|MYB1R_BETVU Transcription factor MYB1 OS=Beta vulgaris GN=MYB1 PE=1 SV=1 11 105 8.0E-09
sp|M1ETK3|MYB1W_BETVU Transcription factor MYB1 OS=Beta vulgaris GN=MYB1 PE=2 SV=1 11 105 8.0E-09
sp|Q9C9C8|MY122_ARATH Transcription factor MYB122 OS=Arabidopsis thaliana GN=MYB122 PE=1 SV=1 10 105 1.0E-08
sp|P48972|MYBB_MOUSE Myb-related protein B OS=Mus musculus GN=Mybl2 PE=1 SV=1 14 109 3.0E-08
sp|Q03237|MYBB_CHICK Myb-related protein B OS=Gallus gallus GN=MYBL2 PE=1 SV=1 14 143 4.0E-08
sp|Q9ZTC3|MYB90_ARATH Transcription factor MYB90 OS=Arabidopsis thaliana GN=MYB90 PE=1 SV=1 10 105 5.0E-08
sp|O80931|AS1_ARATH Transcription factor AS1 OS=Arabidopsis thaliana GN=AS1 PE=1 SV=1 10 116 6.0E-08
sp|Q94IB1|RS2_ORYSJ Protein rough sheath 2 homolog OS=Oryza sativa subsp. japonica GN=RS2 PE=2 SV=1 10 114 7.0E-08
sp|Q9S7B2|RS2_MAIZE Protein rough sheath 2 OS=Zea mays GN=RS2 PE=1 SV=1 10 116 3.0E-07
sp|Q6FUG1|CEF1_CANGA Pre-mRNA-splicing factor CEF1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CEF1 PE=3 SV=1 7 204 1.0E-06
sp|P04197|MYB_DROME Myb protein OS=Drosophila melanogaster GN=Myb PE=1 SV=2 14 143 2.0E-06
sp|Q52G60|CEF1_MAGO7 Pre-mRNA-splicing factor CEF1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CEF1 PE=3 SV=1 10 98 4.0E-06
sp|Q4P652|CEF1_USTMA Pre-mRNA-splicing factor CEF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CEF1 PE=3 SV=1 10 98 6.0E-06
sp|P01104|MYB_AVIMB Transforming protein Myb OS=Avian myeloblastosis virus GN=V-MYB PE=1 SV=2 43 143 8.0E-06
sp|Q54TN2|MYBC_DICDI Myb-like protein C OS=Dictyostelium discoideum GN=mybC PE=1 SV=1 14 97 9.0E-06
sp|Q7SAF6|CEF1_NEUCR Pre-mRNA-splicing factor cef-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cef-1 PE=3 SV=1 10 170 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4589
MALASWLHHKRGPWATVEDSSLLDLVFAHGPLNWVRISQTLGSRTPKQCRERYHQNLKPSLRHDPITPSEGQEIE
RLVQQIGKRWAEIARHLHGRSDNAVKNWWNGNQNRLKRSQRRRANQGYAHQSHAATTPTLPSRPNTSLPSIHSIR
PRLPSLSSLTDEKQLAPPTRPTPQPDARLWQPPLHVNLLTRPSSPRLPQRMLHQIPHRLPPEPNPSPQPQHSTAR
DSRMELSSLLL*
Coding >OphauB2|4589
ATGGCTCTTGCCTCATGGCTCCACCACAAACGAGGACCGTGGGCCACAGTCGAGGACAGCAGTCTGTTGGACCTC
GTCTTTGCCCACGGTCCCCTCAACTGGGTGCGGATTTCCCAGACTTTGGGTTCGCGGACCCCAAAGCAGTGCCGC
GAGCGCTATCACCAGAATCTAAAGCCCTCGCTGAGGCATGACCCCATCACGCCCAGTGAGGGCCAAGAGATTGAG
CGCCTGGTGCAGCAGATTGGCAAGCGCTGGGCTGAGATTGCTCGCCACCTGCATGGCCGCAGCGACAATGCTGTC
AAGAATTGGTGGAACGGCAATCAAAATCGACTCAAACGATCACAACGCCGTCGCGCCAACCAGGGCTACGCGCAC
CAAAGTCACGCCGCCACCACTCCAACCCTACCATCTCGCCCAAACACCAGCCTGCCCTCGATTCACAGTATCCGC
CCGCGACTGCCCAGCTTGAGCTCCCTTACCGATGAGAAGCAGCTTGCTCCACCAACACGGCCTACGCCACAGCCC
GATGCCCGCCTCTGGCAGCCCCCGTTGCATGTCAATTTGTTGACAAGACCCTCTTCACCCAGGCTGCCACAGAGG
ATGCTGCATCAAATTCCACATCGACTGCCCCCCGAGCCGAATCCGTCACCCCAGCCTCAGCACTCAACCGCGAGG
GACTCACGAATGGAACTTTCGTCCCTCCTGCTATGA
Transcript >OphauB2|4589
ATGGCTCTTGCCTCATGGCTCCACCACAAACGAGGACCGTGGGCCACAGTCGAGGACAGCAGTCTGTTGGACCTC
GTCTTTGCCCACGGTCCCCTCAACTGGGTGCGGATTTCCCAGACTTTGGGTTCGCGGACCCCAAAGCAGTGCCGC
GAGCGCTATCACCAGAATCTAAAGCCCTCGCTGAGGCATGACCCCATCACGCCCAGTGAGGGCCAAGAGATTGAG
CGCCTGGTGCAGCAGATTGGCAAGCGCTGGGCTGAGATTGCTCGCCACCTGCATGGCCGCAGCGACAATGCTGTC
AAGAATTGGTGGAACGGCAATCAAAATCGACTCAAACGATCACAACGCCGTCGCGCCAACCAGGGCTACGCGCAC
CAAAGTCACGCCGCCACCACTCCAACCCTACCATCTCGCCCAAACACCAGCCTGCCCTCGATTCACAGTATCCGC
CCGCGACTGCCCAGCTTGAGCTCCCTTACCGATGAGAAGCAGCTTGCTCCACCAACACGGCCTACGCCACAGCCC
GATGCCCGCCTCTGGCAGCCCCCGTTGCATGTCAATTTGTTGACAAGACCCTCTTCACCCAGGCTGCCACAGAGG
ATGCTGCATCAAATTCCACATCGACTGCCCCCCGAGCCGAATCCGTCACCCCAGCCTCAGCACTCAACCGCGAGG
GACTCACGAATGGAACTTTCGTCCCTCCTGCTATGA
Gene >OphauB2|4589
ATGGCTCTTGCCTCATGGCTGTAGGGCGCCATGCACAAGTATAGTGTAATGTAGTGTAATGTAGTGTATCGACTT
TGCTGGGCAAATGCGCACGCACAAGGAGCAGACTTGGCCTGCTTTGCACTGGGACTGCCTGNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCTTGTTGCCTCTAATACTTTTTTTGCT
ACACGCTTCTCGCGTCGCCGCTGACCAGACTGCCTCATAGCGCCCTGGCACCAGCAAACCAGACGCCGTGCTGGA
TCCCGCCCAGTCTCGTCTCGTCTTGTCTTGTCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCGCCCAGCCACCACAAACGAGGACCGTGGGCCAC
AGTCGAGGACAGCAGTCTGTTGGACCTCGTCTTTGCCCACGGTCCCCTCAACTGGGTGCGGATTTCCCAGACTTT
GGGTTCGCGGACCCCAAAGCAGTGCCGCGAGCGCTATCACCAGAATCTAAAGCCCTCGCTGAGGCATGACCCCAT
CACGCCCAGTGAGGGCCAAGAGATTGAGCGCCTGGTGCAGCAGATTGGCAAGCGCTGGGCTGAGATTGCTCGCCA
CCTGCATGGCCGCAGCGACAATGCTGTCAAGAATTGGTGGAACGGCAATCAAAATCGACTCAAACGATCACAACG
CCGTCGCGCCAACCAGGGCTACGCGCACCAAAGTCACGCCGCCACCACTCCAACCCTACCATCTCGCCCAAACAC
CAGCCTGCCCTCGATTCACAGTATCCGCCCGCGACTGCCCAGCTTGAGCTCCCTTACCGATGAGAAGCAGCTTGC
TCCACCAACACGGCCTACGCCACAGCCCGATGCCCGCCTCTGGCAGCCCCCGTTGCATGTCAATTTGTTGACAAG
ACCCTCTTCACCCAGGCTGCCACAGAGGATGCTGCATCAAATTCCACATCGACTGCCCCCCGAGCCGAATCCGTC
ACCCCAGCCTCAGCACTCAACCGCGAGGGACTCACGAATGGAACTTTCGTCCCTCCTGCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail