Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4588
Gene name
LocationContig_305:412..4978
Strand+
Gene length (bp)4566
Transcript length (bp)4347
Coding sequence length (bp)4347
Protein length (aa) 1449

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13844 Glyco_transf_41 Glycosyl transferase family 41 1.9E-48 954 1138
PF13844 Glyco_transf_41 Glycosyl transferase family 41 3.7E-45 1192 1379
PF13181 TPR_8 Tetratricopeptide repeat 1.0E-01 762 792

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 702 1441 4.0E-93
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 1213 1441 3.0E-37
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 1213 1441 4.0E-37
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 1213 1441 8.0E-37
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 1213 1441 1.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 702 1441 4.0E-93
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 1213 1441 3.0E-37
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 1213 1441 4.0E-37
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 1213 1441 8.0E-37
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 1213 1441 1.0E-36
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 1214 1445 2.0E-36
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 955 1185 7.0E-36
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 955 1185 7.0E-36
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 955 1185 7.0E-36
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 955 1185 7.0E-36
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 955 1185 7.0E-36
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 1213 1441 4.0E-35
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 955 1185 5.0E-34
sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida GN=SPY PE=2 SV=1 1002 1441 2.0E-22
sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana GN=SPY PE=1 SV=1 1002 1441 1.0E-21
sp|Q8RVB2|SPY_SOLLC Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum GN=SPY PE=2 SV=1 990 1441 4.0E-20
sp|Q6YZI0|SPY_ORYSJ Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica GN=SPY PE=3 SV=1 1001 1441 1.0E-19
sp|O82422|SPY_HORVU Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare GN=SPY PE=2 SV=1 1001 1441 2.0E-19
sp|Q8LP10|SPY_EUSER Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Eustoma exaltatum subsp. russellianum GN=SPY PE=2 SV=1 1001 1441 7.0E-19
sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 363 817 4.0E-12
sp|A8BFN4|OGT1_GIAIC UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=GL50803_12081 PE=1 SV=1 1213 1441 8.0E-11
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 688 810 3.0E-10
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 688 810 3.0E-10
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 688 810 3.0E-10
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 688 810 3.0E-10
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 688 810 3.0E-10
sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 718 822 1.0E-08
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 711 810 1.0E-08
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 710 899 2.0E-08
sp|A8BFN4|OGT1_GIAIC UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=GL50803_12081 PE=1 SV=1 1008 1137 1.0E-07
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 711 800 2.0E-07
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 715 812 2.0E-07
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 711 800 2.0E-07
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 715 812 2.0E-07
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 711 800 2.0E-07
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 715 812 2.0E-07
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 715 812 2.0E-07
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 711 800 2.0E-07
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 710 804 2.0E-07
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 711 800 2.0E-07
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 715 812 2.0E-07
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 710 804 3.0E-07
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 710 804 3.0E-07
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 710 804 3.0E-07
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 710 804 3.0E-07
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 715 809 3.0E-06
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 715 800 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5075
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|562
Ophiocordyceps australis map64 (Brazil) OphauB2|4588 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06070
Ophiocordyceps camponoti-rufipedis Ophun1|6592
Ophiocordyceps kimflemingae Ophio5|7555
Ophiocordyceps subramaniannii Hirsu2|2911

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4588
MPPHSEAQQSSAGGAREHPRSRQHSQLRRKTPSGVVDAGYEAVDHDGSAQGAGSPPLKHFIIAATIPAAATTTTG
HSGFRQVARPVRASRLSAPRSTRPWDPPPAFQDGSSWTDNDEALGLSPGQAQSSTEHTENKIWTIYRPPAPAMEP
FALDLTSYWPAPIRTTASGSHLYSRYPAGNPSFPLSQISHGVCSSHSMWQLPAPSNWAGSAATIDWQSVCARRSL
TRVRPQLGSKEKALACGYRSYIDLLACLQASGRPGGMPSGSVCLGGSRLSTYPRPPKPTFGSLQAGPRESSIFLS
SLFDVGLATQRPGQAQLALSMAATCQPSCAVSNATNQPKQSLGVSYWSHVQNETTASPMTSAKSALEAVRNVCEQ
SGWRWLDGMLLGGCLCYGLGRYQDAAQWFSRILHIDSSHVETMTNMAAALYCLDRQSEAEQFWLDAIKLRPSYLE
AAEHLVGLLYRKRGPEAVEVISYVQGALRLPDSWLTTQHESRVERKDYGSSGYALPATENGRLLALVHAKGTMLY
NLKQVTKAAEAFEEAVLIATGRRLGKIEDIIRRVQYVLCPPGISNLESRRPLMLPPERARCTAQLVFCGAGEPPG
LLSLRNGASKRAAVQTTSNSLLSLAKIFQDGLSSGNADLCLLVRPLSTVGDVLALYYLSLSLQESPSTANNIGIL
LAGLQQTAALPAVFSGRSLVQGAMPSVRPGSGMSFALAYYNYGLGLDPKHVHLHTNLGSLVKDMGLLDLAISMYE
RAVACDASFDIALTNLANAVKDKGRINDAIVYYRRAVAANPAFCEAVCGLFTALNSVCDWQGRGGVYLACGKYDR
WHVDEQGVLHDVLATGRGSGLTQRVVDIVAEQLREASLWGQHALEASTRATLAHELEWLCQEGCFRLEDALQHWA
GRPWEGARLVRLLERAARVTQHQWYKDVYVSWRRGKAGPYTRPSLPRHLSVPTTPTVLPFHTFTCPLAAREIRAI
SQRNALRITCSTLRSSWLPASVYPPPRPPQPQLNVGYVSSDFNNHPLAHLMQSVFGLHNSNRVRAFCYATTSSDN
STHRRQIEREAPVFREVSNWPLDKVIDIIIQDEIHILVNLNGYTRGARNEIFAARPVPVQMSFMGFAGSLGAEWC
DYILADATAIPPETLRPWRSNTSIQDVFHDGNEDDDYGEWVYSENIIFCRDTFFCCDHAQSCDANERATTWHQEQ
QRRWAMRKAMFPGMADDVIILANFNQLYKIEPTTFRSWLRILARVPKAVLWLLRFPEAGERNLRVTAEAWAGSEV
ASRVFFTDVAAKSHHISRARVCDLFLDTPECNAHTTAADVLWSSTPLLTLPRYPYKMCSRMAASILRGALPRSSE
GRRVAEELIVKNEAEYESAAVRLASGLRYARVALDEPASPSPSYCEGHGRLAEMRRLLWDSKWICGLFDTQRWVD
DVETAYYEAWRRWVHGIGGDIYL*
Coding >OphauB2|4588
ATGCCACCTCACTCGGAGGCTCAGCAGTCGAGTGCTGGCGGCGCCCGAGAGCATCCGCGCTCGCGCCAGCACAGC
CAATTGCGCCGAAAGACTCCCAGTGGGGTCGTCGATGCGGGATATGAAGCGGTGGACCATGATGGAAGTGCGCAA
GGCGCCGGCTCGCCCCCGTTGAAACATTTCATCATTGCTGCCACGATTCCAGCGGCCGCGACGACGACGACTGGG
CATAGCGGCTTTAGACAGGTTGCCCGGCCTGTTCGCGCTTCTCGGCTTTCTGCGCCGCGGTCGACGAGGCCATGG
GACCCGCCGCCTGCGTTTCAAGATGGGTCGTCTTGGACTGACAATGACGAAGCACTCGGGCTGAGCCCTGGCCAA
GCTCAGTCCTCGACCGAGCACACGGAGAACAAGATTTGGACTATATACCGTCCACCGGCTCCGGCAATGGAACCA
TTTGCTCTTGACTTGACGTCTTATTGGCCCGCCCCCATTCGGACAACAGCTTCAGGCAGTCACTTGTACAGTCGC
TACCCAGCAGGCAACCCAAGTTTCCCATTGAGCCAGATTAGCCACGGCGTCTGCTCGTCCCATAGCATGTGGCAG
CTACCAGCACCGAGCAACTGGGCTGGCAGCGCTGCAACTATTGACTGGCAGTCGGTATGCGCACGACGTTCCTTG
ACACGCGTGCGCCCGCAGCTTGGTTCAAAAGAAAAGGCTCTAGCCTGTGGCTATCGAAGCTACATTGATTTGCTA
GCCTGTCTTCAAGCTAGTGGCCGGCCCGGAGGTATGCCCTCGGGTTCTGTCTGTCTGGGAGGCTCTAGGCTGTCG
ACATATCCTCGACCGCCTAAACCAACTTTTGGGTCGTTGCAGGCCGGCCCCCGCGAGAGCTCCATATTTCTCTCT
TCGCTCTTTGACGTTGGCCTTGCCACACAACGCCCCGGACAAGCACAGCTTGCGCTGAGCATGGCCGCCACTTGC
CAGCCGTCTTGTGCAGTTTCCAATGCAACAAATCAACCAAAGCAGTCACTTGGTGTCTCATATTGGAGCCATGTA
CAAAATGAAACAACAGCTTCGCCCATGACTAGCGCCAAATCAGCATTAGAGGCGGTCCGTAATGTCTGCGAACAG
AGCGGCTGGCGCTGGCTTGATGGTATGTTGCTAGGTGGCTGTCTTTGCTATGGTCTAGGCCGCTATCAAGACGCG
GCACAATGGTTCTCGAGAATTCTCCACATAGACTCGAGTCATGTAGAAACCATGACCAACATGGCGGCTGCCCTT
TATTGCCTTGATCGGCAGAGCGAAGCCGAGCAGTTTTGGCTCGATGCTATTAAGCTACGCCCTAGTTACCTGGAA
GCTGCCGAACATCTCGTGGGTCTTCTCTACAGAAAACGGGGCCCCGAAGCTGTCGAGGTGATATCGTATGTGCAA
GGAGCCCTGAGGTTGCCAGACTCATGGCTCACCACTCAGCATGAGAGCCGTGTGGAGCGCAAGGACTATGGCTCG
AGTGGCTATGCCTTGCCAGCGACGGAAAATGGAAGATTATTGGCTCTCGTCCATGCCAAGGGGACCATGCTCTAC
AATTTGAAACAAGTTACAAAGGCTGCTGAAGCGTTTGAAGAAGCCGTGTTGATTGCTACTGGACGGCGCCTTGGC
AAGATTGAAGACATTATACGGCGTGTTCAATATGTGCTATGTCCGCCCGGGATTTCGAATCTTGAGTCACGGCGC
CCTCTGATGCTGCCGCCGGAAAGAGCTCGATGCACGGCACAACTCGTATTTTGTGGTGCTGGAGAGCCGCCAGGC
CTTTTGTCTCTGCGCAACGGGGCATCGAAACGAGCGGCGGTGCAGACAACAAGCAACTCACTGCTATCATTGGCA
AAGATTTTTCAAGATGGCTTGTCAAGCGGCAATGCAGACTTGTGCTTGCTGGTGCGGCCATTATCAACTGTGGGG
GATGTATTAGCACTATATTATCTCTCTCTGTCTCTACAGGAGAGCCCGTCGACAGCCAACAACATTGGCATCCTC
TTGGCTGGCCTTCAGCAGACGGCTGCATTGCCAGCTGTGTTTTCTGGCAGAAGTCTGGTACAGGGTGCGATGCCC
AGTGTCAGGCCAGGAAGTGGAATGTCTTTTGCATTGGCATACTACAATTACGGGCTTGGTTTAGATCCCAAGCAT
GTCCATCTGCACACTAATCTAGGCAGTCTTGTTAAAGATATGGGTCTACTCGATCTCGCCATTTCAATGTATGAG
CGCGCCGTGGCCTGCGACGCCTCTTTTGATATTGCACTGACGAATCTTGCCAATGCGGTCAAGGATAAGGGGCGC
ATCAATGATGCCATAGTCTACTACCGTCGTGCAGTGGCGGCAAACCCTGCGTTTTGCGAAGCAGTCTGTGGACTC
TTTACAGCGCTCAACTCGGTATGTGACTGGCAGGGTCGCGGTGGCGTATATTTGGCCTGTGGAAAATACGACCGG
TGGCATGTCGACGAGCAAGGCGTCTTGCACGACGTGTTGGCGACGGGTCGCGGCAGCGGCTTGACGCAACGCGTT
GTTGATATAGTGGCGGAGCAGCTGAGGGAGGCGTCGCTTTGGGGACAGCATGCGCTTGAAGCATCGACAAGGGCG
ACGCTGGCACATGAGCTGGAATGGCTTTGCCAAGAGGGATGCTTCCGGCTAGAGGATGCACTGCAACATTGGGCA
GGCAGACCATGGGAGGGCGCGCGTCTGGTGCGACTGCTGGAGCGTGCGGCGCGAGTCACACAGCACCAATGGTAC
AAGGACGTGTACGTGTCATGGAGACGGGGCAAAGCAGGGCCATATACTCGTCCGAGCCTGCCCCGGCATCTCTCG
GTGCCGACGACGCCGACGGTGCTGCCTTTTCACACCTTTACGTGCCCGCTCGCGGCCAGGGAGATTCGGGCAATC
TCTCAGCGCAATGCCCTGCGAATAACGTGCTCGACGCTGCGGTCGTCGTGGCTGCCGGCCTCGGTGTACCCACCG
CCACGCCCGCCGCAGCCGCAGCTCAATGTCGGCTATGTCTCGTCAGACTTTAACAACCACCCCTTGGCTCACCTA
ATGCAATCCGTGTTTGGCTTGCACAACTCGAACCGCGTCAGGGCCTTTTGCTACGCCACGACTAGCAGCGACAAT
TCGACGCACCGCCGCCAGATTGAGAGAGAGGCACCCGTATTTCGCGAGGTTAGCAACTGGCCGTTGGACAAGGTT
ATTGACATTATTATTCAAGACGAGATTCACATTCTGGTTAATCTCAACGGCTATACTCGCGGTGCACGTAATGAA
ATCTTTGCTGCTAGACCCGTACCTGTGCAGATGTCCTTTATGGGATTCGCGGGCAGCTTGGGTGCCGAGTGGTGT
GACTATATTCTCGCCGATGCGACGGCCATTCCGCCCGAGACGCTGCGTCCGTGGAGGAGCAACACTAGCATCCAA
GACGTCTTTCATGATGGCAACGAGGACGACGACTATGGCGAATGGGTGTACTCGGAGAACATTATATTCTGCCGC
GACACCTTTTTTTGCTGCGATCATGCTCAGTCATGCGACGCAAACGAGCGCGCAACAACCTGGCACCAGGAGCAA
CAGAGGAGATGGGCTATGCGCAAGGCCATGTTTCCCGGCATGGCAGACGACGTGATTATTCTCGCCAACTTTAAT
CAGCTGTACAAGATTGAGCCAACGACATTTCGCTCGTGGCTACGCATCCTGGCGCGAGTCCCCAAGGCTGTCTTG
TGGTTGCTACGATTTCCCGAGGCTGGTGAGCGCAATCTACGAGTGACGGCCGAGGCATGGGCGGGATCCGAGGTG
GCTAGTCGCGTCTTTTTTACCGACGTGGCGGCCAAGAGCCATCACATCTCGAGAGCACGCGTATGCGATTTATTC
CTGGACACGCCCGAGTGCAATGCGCATACTACGGCAGCCGACGTGCTGTGGTCAAGCACGCCACTACTTACACTG
CCGCGATACCCCTACAAGATGTGTTCACGCATGGCAGCCTCGATCCTGCGGGGAGCGCTTCCGCGGTCGAGCGAG
GGGAGGCGGGTGGCTGAGGAGCTGATTGTCAAGAACGAGGCTGAGTACGAGAGTGCAGCAGTCAGGCTGGCCAGC
GGGCTAAGATATGCGCGGGTGGCACTAGACGAGCCCGCATCACCATCACCCAGTTACTGCGAGGGCCACGGGCGC
TTGGCCGAGATGCGCAGGCTACTATGGGATAGCAAGTGGATCTGTGGACTCTTTGATACGCAACGCTGGGTCGAC
GATGTAGAGACTGCGTATTACGAGGCATGGCGGAGATGGGTCCATGGAATTGGGGGTGACATTTATCTTTAG
Transcript >OphauB2|4588
ATGCCACCTCACTCGGAGGCTCAGCAGTCGAGTGCTGGCGGCGCCCGAGAGCATCCGCGCTCGCGCCAGCACAGC
CAATTGCGCCGAAAGACTCCCAGTGGGGTCGTCGATGCGGGATATGAAGCGGTGGACCATGATGGAAGTGCGCAA
GGCGCCGGCTCGCCCCCGTTGAAACATTTCATCATTGCTGCCACGATTCCAGCGGCCGCGACGACGACGACTGGG
CATAGCGGCTTTAGACAGGTTGCCCGGCCTGTTCGCGCTTCTCGGCTTTCTGCGCCGCGGTCGACGAGGCCATGG
GACCCGCCGCCTGCGTTTCAAGATGGGTCGTCTTGGACTGACAATGACGAAGCACTCGGGCTGAGCCCTGGCCAA
GCTCAGTCCTCGACCGAGCACACGGAGAACAAGATTTGGACTATATACCGTCCACCGGCTCCGGCAATGGAACCA
TTTGCTCTTGACTTGACGTCTTATTGGCCCGCCCCCATTCGGACAACAGCTTCAGGCAGTCACTTGTACAGTCGC
TACCCAGCAGGCAACCCAAGTTTCCCATTGAGCCAGATTAGCCACGGCGTCTGCTCGTCCCATAGCATGTGGCAG
CTACCAGCACCGAGCAACTGGGCTGGCAGCGCTGCAACTATTGACTGGCAGTCGGTATGCGCACGACGTTCCTTG
ACACGCGTGCGCCCGCAGCTTGGTTCAAAAGAAAAGGCTCTAGCCTGTGGCTATCGAAGCTACATTGATTTGCTA
GCCTGTCTTCAAGCTAGTGGCCGGCCCGGAGGTATGCCCTCGGGTTCTGTCTGTCTGGGAGGCTCTAGGCTGTCG
ACATATCCTCGACCGCCTAAACCAACTTTTGGGTCGTTGCAGGCCGGCCCCCGCGAGAGCTCCATATTTCTCTCT
TCGCTCTTTGACGTTGGCCTTGCCACACAACGCCCCGGACAAGCACAGCTTGCGCTGAGCATGGCCGCCACTTGC
CAGCCGTCTTGTGCAGTTTCCAATGCAACAAATCAACCAAAGCAGTCACTTGGTGTCTCATATTGGAGCCATGTA
CAAAATGAAACAACAGCTTCGCCCATGACTAGCGCCAAATCAGCATTAGAGGCGGTCCGTAATGTCTGCGAACAG
AGCGGCTGGCGCTGGCTTGATGGTATGTTGCTAGGTGGCTGTCTTTGCTATGGTCTAGGCCGCTATCAAGACGCG
GCACAATGGTTCTCGAGAATTCTCCACATAGACTCGAGTCATGTAGAAACCATGACCAACATGGCGGCTGCCCTT
TATTGCCTTGATCGGCAGAGCGAAGCCGAGCAGTTTTGGCTCGATGCTATTAAGCTACGCCCTAGTTACCTGGAA
GCTGCCGAACATCTCGTGGGTCTTCTCTACAGAAAACGGGGCCCCGAAGCTGTCGAGGTGATATCGTATGTGCAA
GGAGCCCTGAGGTTGCCAGACTCATGGCTCACCACTCAGCATGAGAGCCGTGTGGAGCGCAAGGACTATGGCTCG
AGTGGCTATGCCTTGCCAGCGACGGAAAATGGAAGATTATTGGCTCTCGTCCATGCCAAGGGGACCATGCTCTAC
AATTTGAAACAAGTTACAAAGGCTGCTGAAGCGTTTGAAGAAGCCGTGTTGATTGCTACTGGACGGCGCCTTGGC
AAGATTGAAGACATTATACGGCGTGTTCAATATGTGCTATGTCCGCCCGGGATTTCGAATCTTGAGTCACGGCGC
CCTCTGATGCTGCCGCCGGAAAGAGCTCGATGCACGGCACAACTCGTATTTTGTGGTGCTGGAGAGCCGCCAGGC
CTTTTGTCTCTGCGCAACGGGGCATCGAAACGAGCGGCGGTGCAGACAACAAGCAACTCACTGCTATCATTGGCA
AAGATTTTTCAAGATGGCTTGTCAAGCGGCAATGCAGACTTGTGCTTGCTGGTGCGGCCATTATCAACTGTGGGG
GATGTATTAGCACTATATTATCTCTCTCTGTCTCTACAGGAGAGCCCGTCGACAGCCAACAACATTGGCATCCTC
TTGGCTGGCCTTCAGCAGACGGCTGCATTGCCAGCTGTGTTTTCTGGCAGAAGTCTGGTACAGGGTGCGATGCCC
AGTGTCAGGCCAGGAAGTGGAATGTCTTTTGCATTGGCATACTACAATTACGGGCTTGGTTTAGATCCCAAGCAT
GTCCATCTGCACACTAATCTAGGCAGTCTTGTTAAAGATATGGGTCTACTCGATCTCGCCATTTCAATGTATGAG
CGCGCCGTGGCCTGCGACGCCTCTTTTGATATTGCACTGACGAATCTTGCCAATGCGGTCAAGGATAAGGGGCGC
ATCAATGATGCCATAGTCTACTACCGTCGTGCAGTGGCGGCAAACCCTGCGTTTTGCGAAGCAGTCTGTGGACTC
TTTACAGCGCTCAACTCGGTATGTGACTGGCAGGGTCGCGGTGGCGTATATTTGGCCTGTGGAAAATACGACCGG
TGGCATGTCGACGAGCAAGGCGTCTTGCACGACGTGTTGGCGACGGGTCGCGGCAGCGGCTTGACGCAACGCGTT
GTTGATATAGTGGCGGAGCAGCTGAGGGAGGCGTCGCTTTGGGGACAGCATGCGCTTGAAGCATCGACAAGGGCG
ACGCTGGCACATGAGCTGGAATGGCTTTGCCAAGAGGGATGCTTCCGGCTAGAGGATGCACTGCAACATTGGGCA
GGCAGACCATGGGAGGGCGCGCGTCTGGTGCGACTGCTGGAGCGTGCGGCGCGAGTCACACAGCACCAATGGTAC
AAGGACGTGTACGTGTCATGGAGACGGGGCAAAGCAGGGCCATATACTCGTCCGAGCCTGCCCCGGCATCTCTCG
GTGCCGACGACGCCGACGGTGCTGCCTTTTCACACCTTTACGTGCCCGCTCGCGGCCAGGGAGATTCGGGCAATC
TCTCAGCGCAATGCCCTGCGAATAACGTGCTCGACGCTGCGGTCGTCGTGGCTGCCGGCCTCGGTGTACCCACCG
CCACGCCCGCCGCAGCCGCAGCTCAATGTCGGCTATGTCTCGTCAGACTTTAACAACCACCCCTTGGCTCACCTA
ATGCAATCCGTGTTTGGCTTGCACAACTCGAACCGCGTCAGGGCCTTTTGCTACGCCACGACTAGCAGCGACAAT
TCGACGCACCGCCGCCAGATTGAGAGAGAGGCACCCGTATTTCGCGAGGTTAGCAACTGGCCGTTGGACAAGGTT
ATTGACATTATTATTCAAGACGAGATTCACATTCTGGTTAATCTCAACGGCTATACTCGCGGTGCACGTAATGAA
ATCTTTGCTGCTAGACCCGTACCTGTGCAGATGTCCTTTATGGGATTCGCGGGCAGCTTGGGTGCCGAGTGGTGT
GACTATATTCTCGCCGATGCGACGGCCATTCCGCCCGAGACGCTGCGTCCGTGGAGGAGCAACACTAGCATCCAA
GACGTCTTTCATGATGGCAACGAGGACGACGACTATGGCGAATGGGTGTACTCGGAGAACATTATATTCTGCCGC
GACACCTTTTTTTGCTGCGATCATGCTCAGTCATGCGACGCAAACGAGCGCGCAACAACCTGGCACCAGGAGCAA
CAGAGGAGATGGGCTATGCGCAAGGCCATGTTTCCCGGCATGGCAGACGACGTGATTATTCTCGCCAACTTTAAT
CAGCTGTACAAGATTGAGCCAACGACATTTCGCTCGTGGCTACGCATCCTGGCGCGAGTCCCCAAGGCTGTCTTG
TGGTTGCTACGATTTCCCGAGGCTGGTGAGCGCAATCTACGAGTGACGGCCGAGGCATGGGCGGGATCCGAGGTG
GCTAGTCGCGTCTTTTTTACCGACGTGGCGGCCAAGAGCCATCACATCTCGAGAGCACGCGTATGCGATTTATTC
CTGGACACGCCCGAGTGCAATGCGCATACTACGGCAGCCGACGTGCTGTGGTCAAGCACGCCACTACTTACACTG
CCGCGATACCCCTACAAGATGTGTTCACGCATGGCAGCCTCGATCCTGCGGGGAGCGCTTCCGCGGTCGAGCGAG
GGGAGGCGGGTGGCTGAGGAGCTGATTGTCAAGAACGAGGCTGAGTACGAGAGTGCAGCAGTCAGGCTGGCCAGC
GGGCTAAGATATGCGCGGGTGGCACTAGACGAGCCCGCATCACCATCACCCAGTTACTGCGAGGGCCACGGGCGC
TTGGCCGAGATGCGCAGGCTACTATGGGATAGCAAGTGGATCTGTGGACTCTTTGATACGCAACGCTGGGTCGAC
GATGTAGAGACTGCGTATTACGAGGCATGGCGGAGATGGGTCCATGGAATTGGGGGTGACATTTATCTTTAG
Gene >OphauB2|4588
ATGCCACCTCACTCGGAGGCTCAGCAGTCGAGTGCTGGCGGCGCCCGAGAGCATCCGCGCTCGCGCCAGCACAGC
CAATTGCGCCGAAAGACTCCCAGTGGGGTCGTCGATGCGGGATATGAAGCGGTGGACCATGATGGAAGTGCGCAA
GGCGCCGGCTCGCCCCCGTTGAAACATTTCATCATTGCTGCCACGATTCCAGCGGCCGCGACGACGACGACTGGG
CATAGCGGCTTTAGACAGGTTGCCCGGCCTGTTCGCGCTTCTCGGCTTTCTGCGCCGCGGTCGACGAGGCCATGG
GACCCGCCGCCTGCGTTTCAAGATGGGTCGTCTTGGACTGACAATGACGAAGCACTCGGGCTGAGCCCTGGCCAA
GCTCAGTCCTCGACCGAGCACACGGAGAACAAGATTTGGACTATATACCGTCCACCGGCTCCGGCAATGGAACCA
TTTGCTCTTGACTTGACGTCTTATTGGCCCGCCCCCATTCGGACAACAGCTTCAGGCAGTCACTTGTACAGTCGC
TACCCAGCAGGCAACCCAAGTTTCCCATTGAGCCAGATTAGCCACGGCGTCTGCTCGTCCCATAGCATGTGGCAG
CTACCAGCACCGAGCAACTGGGCTGGCAGCGCTGCAACTATTGACTGGCAGTCGGTATGCGCACGACGTTCCTTG
ACACGCGTGCGCCCGCAGCTTGGTTCAAAAGAAAAGGCTCTAGCCTGTGGCTATCGAAGCTACATTGATTTGCTA
GCCTGTCTTCAAGCTAGTGGCCGGCCCGGAGGTATGCCCTCGGGTTCTGTCTGTCTGGGAGGCTCTAGGCTGTCG
ACATATCCTCGACCGCCTAAACCAACTTTTGGGTCGTTGCAGGCCGGCCCCCGCGAGAGCTCCATATTTCTCTCT
TCGCTCTTTGACGTTGGCCTTGCCACACAACGCCCCGGACAAGCACAGCTTGCGCTGAGCATGGCCGCCACTTGC
CAGCCGTCTTGTGCAGTTTCCAATGCAACAAATCAACCAAAGCAGTCACTTGGTGTCTCATATTGGAGCCATGTA
CAAAATGAAACAACAGCTTCGCCCATGACTAGCGCCAAATCAGCATTAGAGGCGGTCCGTAATGTCTGCGAACAG
AGCGGCTGGCGCTGGCTTGATGGTATGTTGCTAGGTGGCTGTCTTTGCTATGGTCTAGGCCGCTATCAAGACGCG
GCACAATGGTTCTCGAGAATTCTCCACATAGACTCGAGGTAAAGGCCGATCCAGATGATGAACTGTCAAGTGGCC
GTTCTCCATGTCTGACTCATTTTCGCAGTCATGTAGAAACCATGACCAACATGGCGGCTGCCCTTTATTGCCTTG
ATCGGCAGAGCGAAGCCGAGCAGTTTTGGCTCGATGCTATTAAGCTACGCCCTAGTTACCTGGAAGCTGCCGAAC
ATCTCGTGGGTCTTCTCTACAGAAAACGGGGCCCCGAAGCTGTCGAGGTGATATCGTATGTGCAAGGAGCCCTGA
GGTTGCCAGACTCATGGCTCACCACTCAGCATGAGAGCCGTGTGGAGCGCAAGGACTATGGCTCGAGTGGCTATG
CCTTGCCAGCGACGGAAAATGGAAGATTATTGGCTCTCGTCCATGCCAAGGGGACCATGCTCTACAATTTGAAAC
AAGTTACAAAGGCTGCTGAAGCGTTTGAAGAAGCCGTGTTGATTGCTACTGGACGGCGCCTTGGCAAGATTGAAG
ACATTATACGGCGTGTTCAATATGTGCTATGTCCGCCCGGGATTTCGAATCTTGAGTCACGGCGCCCTCTGATGC
TGCCGCCGGAAAGAGCTCGATGCACGGCACAACTCGTATTTTGTGGTGCTGGAGAGCCGCCAGGCCTTTTGTCTC
TGCGCAACGGGGCATCGAAACGAGCGGCGGTGCAGACAACAAGCAACTCACTGCTATCATTGGCAAAGATTTTTC
AAGATGGCTTGTCAAGCGGCAATGCAGACTTGTGCTTGCTGGTGCGGCCATTATCAACTGTGGGGGATGTATTAG
CACTATATTATCTCTCTCTGTCTCTACAGGAGAGCCCGTCGACAGCCAACAACATTGGCATCCTCTTGGCTGGCC
TTCAGCAGACGGCTGCATTGCCAGCTGTGTTTTCTGGCAGAAGTCTGGTACAGGGTGCGATGCCCAGTGTCAGGC
CAGGAAGTGGAATGTCTTTTGCATTGGCATACTACAATTACGGGCTTGGTTTAGATCCCAAGCATGTCCATCTGC
ACACTAATCTAGGCAGTCTTGTTAAAGATATGGGTCTACTCGATCTCGCCATTTCAATGTATGAGCGCGCCGTGG
CCTGCGACGCCTCTTTTGATATTGCACTGACGAATCTTGCCAATGCGGTCAAGGATAAGGGGCGCATCAATGATG
CCATAGTCTACTACCGTCGTGCAGTGGCGGCAAACCCTGCGTTTTGCGAAGCAGTCTGTGGACTCTTTACAGCGC
TCAACTCGGTATGTGACTGGCAGGGTCGCGGTGGCGTATATTTGGCCTGTGGAAAATACGACCGGTGGCATGTCG
ACGAGCAAGGCGTCTTGCACGACGTGTTGGCGACGGGTCGCGGCAGCGGCTTGACGCAACGCGTTGTTGATATAG
TGGCGGAGCAGCTGAGGGAGGCGTCGCTTTGGGGACAGCATGCGCTTGAAGCATCGACAAGGGCGACGCTGGCAC
ATGAGCTGGAATGGCTTTGCCAAGAGGGATGCTTCCGGCTAGAGGATGCACTGCAACATTGGGCAGGCAGACCAT
GGGAGGGCGCGCGTCTGGTGCGACTGCTGGAGCGTGCGGCGCGAGTCACACAGCACCAATGGTACAAGGACGTGT
ACGTGTCATGGAGACGGGGCAAAGCAGGGCCATATACTCGTCCGAGCCTGCCCCGGCATCTCTCGGTGCCGACGA
CGCCGACGGTGCTGCCTTTTCACACCTTTACGTGCCCGCTCGCGGCCAGGGAGATTCGGGCAATCTCTCAGCGCA
ATGCCCTGCGAATAACGTGCTCGACGCTGCGGTCGTCGTGGCTGCCGGCCTCGGTGTACCCACCGCCACGCCCGC
CGCAGCCGCAGCTCAATGTCGGCTATGTCTCGTCAGACTTTAACAACCACCCCTTGGCTCACCTGTGAGTAGCTG
CAAAAGAGAGTCTTGATGGCACGTCTTGATGCAAAAGCTAATCATGTGTGTGGGTTTGCTGCCAGAATGCAATCC
GTGTTTGGCTTGCACAACTCGAACCGCGTCAGGGCCTTTTGCTACGCCACGACTAGCAGCGACAATTCGACGCAC
CGCCGCCAGATTGAGAGAGAGGCACCCGTATTTCGCGAGGTTAGCAACTGGCCGTTGGACAAGGTTATTGACATT
ATTATTCAAGACGAGATTCACATTCTGGTTAATCTCAACGGCTATACTCGCGGTGCACGTAATGAAATCTTTGCT
GCTAGACCCGTACCTGTGCAGATGTCCTTTATGGGATTCGCGGGCAGCTTGGGTGCCGAGTGGTGTGACTATATT
CTCGCCGATGCGACGGCCATTCCGCCCGAGACGCTGCGTCCGTGGAGGAGCAACACTAGCATCCAAGACGTCTTT
CATGATGGCAACGAGGACGACGACTATGGCGAATGGGTGTACTCGGAGAACATTATATTCTGCCGCGACACCTTT
TTTTGCTGCGATCATGCTCAGTCATGCGACGCAAACGAGCGCGCAACAACCTGGCACCAGGAGCAACAGAGGAGA
TGGGCTATGCGCAAGGCCATGTTTCCCGGCATGGCAGACGACGTGATTATTCTCGCCAACTTTAATCAGCTGTAC
AAGGTAAGCCGCGTCTGGAAGTGGAAGCTTGCTGCGCCGTGCCGTGCCAGCGACTGACTGCTGTATCTGTATTGC
AACCAGATTGAGCCAACGACATTTCGCTCGTGGCTACGCATCCTGGCGCGAGTCCCCAAGGCTGTCTTGTGGTTG
CTACGATTTCCCGAGGCTGGTGAGCGCAATCTACGAGTGACGGCCGAGGCATGGGCGGGATCCGAGGTGGCTAGT
CGCGTCTTTTTTACCGACGTGGCGGCCAAGAGCCATCACATCTCGAGAGCACGCGTATGCGATTTATTCCTGGAC
ACGCCCGAGTGCAATGCGCATACTACGGCAGCCGACGTGCTGTGGTCAAGCACGCCACTACTTACACTGCCGCGA
TACCCCTACAAGATGTGTTCACGCATGGCAGCCTCGATCCTGCGGGGAGCGCTTCCGCGGTCGAGCGAGGGGAGG
CGGGTGGCTGAGGAGCTGATTGTCAAGAACGAGGCTGAGTACGAGAGTGCAGCAGTCAGGCTGGCCAGCGGGCTA
AGATATGCGCGGGTGGCACTAGACGAGCCCGCATCACCATCACCCAGTTACTGCGAGGGCCACGGGCGCTTGGCC
GAGATGCGCAGGCTACTATGGGATAGCAAGTGGATCTGTGGACTCTTTGATACGCAACGCTGGGTCGACGATGTA
GAGACTGCGTATTACGAGGCATGGCGGAGATGGGTCCATGGAATTGGGGGTGACATTTATCTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail