© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | OphauB2|4582 |
| Gene name | |
| Location | Contig_303:205..2002 |
| Strand | + |
| Gene length (bp) | 1797 |
| Transcript length (bp) | 1566 |
| Coding sequence length (bp) | 1566 |
| Protein length (aa) | 522 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00155 | Aminotran_1_2 | Aminotransferase class I and II | 4.9E-33 | 124 | 498 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O59682|LCB1_SCHPO | Serine palmitoyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcb1 PE=3 SV=1 | 24 | 521 | 2.0E-140 |
| sp|P25045|LCB1_YEAST | Serine palmitoyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB1 PE=1 SV=2 | 23 | 508 | 1.0E-97 |
| sp|Q7G4P2|LCB1C_ORYSJ | Long chain base biosynthesis protein 1c OS=Oryza sativa subsp. japonica GN=Os10g0189600 PE=2 SV=2 | 53 | 422 | 3.0E-91 |
| sp|Q94IB8|LCB1_ARATH | Long chain base biosynthesis protein 1 OS=Arabidopsis thaliana GN=LCB1 PE=1 SV=1 | 42 | 512 | 2.0E-90 |
| sp|O35704|SPTC1_MOUSE | Serine palmitoyltransferase 1 OS=Mus musculus GN=Sptlc1 PE=1 SV=2 | 29 | 512 | 3.0E-90 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O59682|LCB1_SCHPO | Serine palmitoyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcb1 PE=3 SV=1 | 24 | 521 | 2.0E-140 |
| sp|P25045|LCB1_YEAST | Serine palmitoyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB1 PE=1 SV=2 | 23 | 508 | 1.0E-97 |
| sp|Q7G4P2|LCB1C_ORYSJ | Long chain base biosynthesis protein 1c OS=Oryza sativa subsp. japonica GN=Os10g0189600 PE=2 SV=2 | 53 | 422 | 3.0E-91 |
| sp|Q94IB8|LCB1_ARATH | Long chain base biosynthesis protein 1 OS=Arabidopsis thaliana GN=LCB1 PE=1 SV=1 | 42 | 512 | 2.0E-90 |
| sp|O35704|SPTC1_MOUSE | Serine palmitoyltransferase 1 OS=Mus musculus GN=Sptlc1 PE=1 SV=2 | 29 | 512 | 3.0E-90 |
| sp|Q6K8E7|LCB1B_ORYSJ | Long chain base biosynthesis protein 1b OS=Oryza sativa subsp. japonica GN=Os02g0806900 PE=2 SV=1 | 53 | 422 | 4.0E-90 |
| sp|O54695|SPTC1_CRIGR | Serine palmitoyltransferase 1 OS=Cricetulus griseus GN=SPTLC1 PE=1 SV=1 | 29 | 512 | 6.0E-90 |
| sp|Q10P01|LCB1A_ORYSJ | Long chain base biosynthesis protein 1a OS=Oryza sativa subsp. japonica GN=Os03g0252800 PE=2 SV=1 | 47 | 422 | 7.0E-89 |
| sp|P91079|SPTC1_CAEEL | Serine palmitoyltransferase 1 OS=Caenorhabditis elegans GN=sptl-1 PE=3 SV=1 | 73 | 505 | 8.0E-89 |
| sp|Q55FL5|SPTC1_DICDI | Serine palmitoyltransferase 1 OS=Dictyostelium discoideum GN=sptA PE=3 SV=1 | 51 | 512 | 1.0E-87 |
| sp|Q60HD1|SPTC1_MACFA | Serine palmitoyltransferase 1 OS=Macaca fascicularis GN=SPTLC1 PE=2 SV=1 | 29 | 512 | 7.0E-85 |
| sp|Q5R9T5|SPTC1_PONAB | Serine palmitoyltransferase 1 OS=Pongo abelii GN=SPTLC1 PE=2 SV=1 | 29 | 512 | 1.0E-83 |
| sp|O15269|SPTC1_HUMAN | Serine palmitoyltransferase 1 OS=Homo sapiens GN=SPTLC1 PE=1 SV=1 | 29 | 512 | 6.0E-83 |
| sp|Q3MHG1|SPTC1_BOVIN | Serine palmitoyltransferase 1 OS=Bos taurus GN=SPTLC1 PE=2 SV=1 | 86 | 512 | 9.0E-82 |
| sp|P40970|LCB2_YEAST | Serine palmitoyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB2 PE=1 SV=1 | 127 | 421 | 1.0E-40 |
| sp|B0K590|BIOF_THEPX | 8-amino-7-oxononanoate synthase OS=Thermoanaerobacter sp. (strain X514) GN=Teth514_0779 PE=3 SV=1 | 105 | 399 | 2.0E-38 |
| sp|B0KC20|BIOF_THEP3 | 8-amino-7-oxononanoate synthase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=Teth39_0287 PE=3 SV=1 | 105 | 399 | 2.0E-38 |
| sp|O15270|SPTC2_HUMAN | Serine palmitoyltransferase 2 OS=Homo sapiens GN=SPTLC2 PE=1 SV=1 | 84 | 421 | 3.0E-38 |
| sp|Q09925|LCB2_SCHPO | Serine palmitoyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcb2 PE=3 SV=1 | 127 | 382 | 4.0E-38 |
| sp|P97363|SPTC2_MOUSE | Serine palmitoyltransferase 2 OS=Mus musculus GN=Sptlc2 PE=1 SV=2 | 123 | 421 | 5.0E-38 |
| sp|A6TU88|BIOF_ALKMQ | 8-amino-7-oxononanoate synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=Amet_3634 PE=3 SV=1 | 105 | 418 | 7.0E-38 |
| sp|A9BGL0|BIOF_PETMO | 8-amino-7-oxononanoate synthase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=Pmob_1549 PE=3 SV=1 | 121 | 418 | 1.0E-37 |
| sp|Q9M304|LCB2B_ARATH | Long chain base biosynthesis protein 2b OS=Arabidopsis thaliana GN=LCB2b PE=1 SV=1 | 127 | 500 | 1.0E-37 |
| sp|O54694|SPTC2_CRIGR | Serine palmitoyltransferase 2 OS=Cricetulus griseus GN=SPTLC2 PE=2 SV=1 | 84 | 421 | 3.0E-37 |
| sp|Q8RYL1|LCB2B_ORYSJ | Long chain base biosynthesis protein 2b OS=Oryza sativa subsp. japonica GN=Os01g0928600 PE=2 SV=1 | 127 | 423 | 6.0E-37 |
| sp|Q8RYL0|LCB2C_ORYSJ | Long chain base biosynthesis protein 2c OS=Oryza sativa subsp. japonica GN=Os01g0928700 PE=3 SV=1 | 127 | 421 | 9.0E-37 |
| sp|Q54EX5|SPTC2_DICDI | Serine palmitoyltransferase 2 OS=Dictyostelium discoideum GN=sptB PE=1 SV=1 | 116 | 421 | 3.0E-36 |
| sp|Q67N86|BIOF_SYMTH | 8-amino-7-oxononanoate synthase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=STH1872 PE=3 SV=1 | 112 | 500 | 5.0E-36 |
| sp|Q5JK39|LCB2D_ORYSJ | Long chain base biosynthesis protein 2d OS=Oryza sativa subsp. japonica GN=Os01g0928800 PE=2 SV=1 | 127 | 421 | 8.0E-36 |
| sp|Q9LSZ9|LCB2A_ARATH | Long chain base biosynthesis protein 2a OS=Arabidopsis thaliana GN=LCB2a PE=1 SV=1 | 127 | 421 | 1.0E-35 |
| sp|P48241|LCB2_KLULA | Serine palmitoyltransferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LCB2 PE=3 SV=2 | 127 | 498 | 2.0E-35 |
| sp|Q9NUV7|SPTC3_HUMAN | Serine palmitoyltransferase 3 OS=Homo sapiens GN=SPTLC3 PE=1 SV=3 | 123 | 467 | 5.0E-35 |
| sp|B7ID58|BIOF_THEAB | 8-amino-7-oxononanoate synthase OS=Thermosipho africanus (strain TCF52B) GN=THA_1494 PE=3 SV=1 | 121 | 399 | 5.0E-35 |
| sp|Q6GJB8|PPAT_STAAR | Putative pyridoxal phosphate-dependent acyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=SAR0555 PE=3 SV=1 | 105 | 399 | 7.0E-35 |
| sp|Q8NXY3|PPAT_STAAW | Putative pyridoxal phosphate-dependent acyltransferase OS=Staphylococcus aureus (strain MW2) GN=MW0505 PE=3 SV=1 | 105 | 399 | 8.0E-35 |
| sp|Q6GBT7|PPAT_STAAS | Putative pyridoxal phosphate-dependent acyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=SAS0508 PE=3 SV=1 | 105 | 399 | 8.0E-35 |
| sp|P60120|PPAT_STAAN | Putative pyridoxal phosphate-dependent acyltransferase OS=Staphylococcus aureus (strain N315) GN=SA0508 PE=1 SV=1 | 105 | 399 | 8.0E-35 |
| sp|P60121|PPAT_STAAM | Putative pyridoxal phosphate-dependent acyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0550 PE=3 SV=1 | 105 | 399 | 8.0E-35 |
| sp|A7HMM1|BIOF_FERNB | 8-amino-7-oxononanoate synthase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=Fnod_1307 PE=3 SV=1 | 121 | 418 | 1.0E-34 |
| sp|Q5HIC5|PPAT_STAAC | Putative pyridoxal phosphate-dependent acyltransferase OS=Staphylococcus aureus (strain COL) GN=SACOL0596 PE=3 SV=1 | 105 | 399 | 1.0E-34 |
| sp|Q2R3K3|LCB2A_ORYSJ | Long chain base biosynthesis protein 2a OS=Oryza sativa subsp. japonica GN=Os11g0516000 PE=2 SV=1 | 118 | 421 | 2.0E-34 |
| sp|Q8EM07|PPAT_OCEIH | Putative pyridoxal phosphate-dependent acyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB3054 PE=3 SV=1 | 105 | 391 | 2.0E-34 |
| sp|Q749W3|BIOF_GEOSL | 8-amino-7-oxononanoate synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=bioF PE=3 SV=1 | 99 | 364 | 3.0E-34 |
| sp|A8MEX7|BIOF_ALKOO | 8-amino-7-oxononanoate synthase OS=Alkaliphilus oremlandii (strain OhILAs) GN=Clos_0909 PE=3 SV=1 | 67 | 461 | 4.0E-34 |
| sp|Q7NNL4|BIOF_GLOVI | Putative 8-amino-7-oxononanoate synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=bioF PE=3 SV=1 | 111 | 413 | 1.0E-33 |
| sp|B0C205|BIOF_ACAM1 | Putative 8-amino-7-oxononanoate synthase OS=Acaryochloris marina (strain MBIC 11017) GN=bioF PE=3 SV=1 | 114 | 399 | 3.0E-33 |
| sp|A6LMP4|BIOF_THEM4 | 8-amino-7-oxononanoate synthase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=Tmel_1346 PE=3 SV=1 | 121 | 399 | 6.0E-33 |
| sp|P22806|BIOF_LYSSH | 8-amino-7-oxononanoate synthase OS=Lysinibacillus sphaericus GN=bioF PE=1 SV=1 | 121 | 421 | 8.0E-33 |
| sp|Q81I05|PPAT_BACCR | Putative pyridoxal phosphate-dependent acyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_0621 PE=3 SV=1 | 98 | 399 | 1.0E-32 |
| sp|Q73KM3|BIOF_TREDE | 8-amino-7-oxononanoate synthase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_2194 PE=3 SV=1 | 99 | 399 | 1.0E-32 |
| sp|Q8BG54|SPTC3_MOUSE | Serine palmitoyltransferase 3 OS=Mus musculus GN=Sptlc3 PE=2 SV=1 | 124 | 399 | 2.0E-32 |
| sp|Q9XVI6|SPTC3_CAEEL | Serine palmitoyltransferase 3 OS=Caenorhabditis elegans GN=sptl-3 PE=3 SV=2 | 125 | 420 | 2.0E-32 |
| sp|O31777|BIOF1_BACSU | 8-amino-7-oxononanoate synthase 1 OS=Bacillus subtilis (strain 168) GN=kbl PE=3 SV=1 | 114 | 399 | 3.0E-32 |
| sp|B5ELF7|BIOF_ACIF5 | 8-amino-7-oxononanoate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=bioF PE=3 SV=1 | 111 | 434 | 3.0E-32 |
| sp|B7J3Y7|BIOF_ACIF2 | 8-amino-7-oxononanoate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=bioF PE=3 SV=1 | 111 | 434 | 3.0E-32 |
| sp|Q81V80|PPAT_BACAN | Putative pyridoxal phosphate-dependent acyltransferase OS=Bacillus anthracis GN=BA_0620 PE=3 SV=1 | 98 | 399 | 4.0E-32 |
| sp|B9IWY0|BIOF_BACCQ | Putative 8-amino-7-oxononanoate synthase OS=Bacillus cereus (strain Q1) GN=bioF PE=3 SV=1 | 123 | 392 | 1.0E-31 |
| sp|B7HNN4|BIOF_BACC7 | Putative 8-amino-7-oxononanoate synthase OS=Bacillus cereus (strain AH187) GN=bioF PE=3 SV=1 | 123 | 392 | 1.0E-31 |
| sp|B8J3V0|BIOF_DESDA | Putative 8-amino-7-oxononanoate synthase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=bioF PE=3 SV=1 | 121 | 511 | 4.0E-31 |
| sp|A7Z4X1|BIOF1_BACMF | 8-amino-7-oxononanoate synthase 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=RBAM_016840 PE=3 SV=1 | 89 | 399 | 4.0E-31 |
| sp|A7GSE1|BIOF_BACCN | Putative 8-amino-7-oxononanoate synthase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=bioF PE=3 SV=1 | 119 | 364 | 9.0E-31 |
| sp|Q731H9|BIOF_BACC1 | Putative 8-amino-7-oxononanoate synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=bioF PE=3 SV=1 | 127 | 364 | 1.0E-30 |
| sp|P9WQ85|BIOF2_MYCTU | Putative 8-amino-7-oxononanoate synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bioF2 PE=1 SV=1 | 23 | 359 | 1.0E-30 |
| sp|P9WQ84|BIOF2_MYCTO | Putative 8-amino-7-oxononanoate synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bioF2 PE=3 SV=1 | 23 | 359 | 1.0E-30 |
| sp|B5Y9Z4|BIOF_COPPD | 8-amino-7-oxononanoate synthase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=COPRO5265_1289 PE=3 SV=2 | 97 | 399 | 2.0E-30 |
| sp|Q635G4|BIOF_BACCZ | Putative 8-amino-7-oxononanoate synthase OS=Bacillus cereus (strain ZK / E33L) GN=bioF PE=3 SV=1 | 127 | 392 | 3.0E-30 |
| sp|Q20375|SPTC2_CAEEL | Serine palmitoyltransferase 2 OS=Caenorhabditis elegans GN=sptl-2 PE=3 SV=1 | 124 | 368 | 5.0E-30 |
| sp|B7GHW7|BIOF_ANOFW | Putative 8-amino-7-oxononanoate synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=bioF PE=3 SV=1 | 121 | 408 | 6.0E-30 |
| sp|Q65ML1|BIOF_BACLD | Putative 8-amino-7-oxononanoate synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=bioF PE=3 SV=1 | 126 | 400 | 6.0E-30 |
| sp|B1XL23|BIOF_SYNP2 | Putative 8-amino-7-oxononanoate synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=bioF PE=3 SV=1 | 108 | 415 | 6.0E-30 |
| sp|Q5KY23|BIOF_GEOKA | Putative 8-amino-7-oxononanoate synthase OS=Geobacillus kaustophilus (strain HTA426) GN=bioF PE=3 SV=1 | 121 | 424 | 1.0E-29 |
| sp|B7KD70|BIOF_CYAP7 | Putative 8-amino-7-oxononanoate synthase OS=Cyanothece sp. (strain PCC 7424) GN=bioF PE=3 SV=1 | 113 | 399 | 2.0E-29 |
| sp|B7JLX2|BIOF_BACC0 | Putative 8-amino-7-oxononanoate synthase OS=Bacillus cereus (strain AH820) GN=bioF PE=3 SV=1 | 127 | 392 | 2.0E-29 |
| sp|Q81MB0|BIOF_BACAN | Putative 8-amino-7-oxononanoate synthase OS=Bacillus anthracis GN=bioF PE=3 SV=1 | 127 | 392 | 2.0E-29 |
| sp|A3DBD5|BIOF_CLOTH | Putative 8-amino-7-oxononanoate synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=bioF PE=3 SV=1 | 121 | 407 | 2.0E-29 |
| sp|Q6HE48|BIOF_BACHK | Putative 8-amino-7-oxononanoate synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=bioF PE=3 SV=1 | 127 | 392 | 2.0E-29 |
| sp|A5G6I9|BIOF_GEOUR | 8-amino-7-oxononanoate synthase OS=Geobacter uraniireducens (strain Rf4) GN=bioF PE=3 SV=1 | 121 | 382 | 3.0E-29 |
| sp|B7IWN1|BIOF_BACC2 | Putative 8-amino-7-oxononanoate synthase OS=Bacillus cereus (strain G9842) GN=bioF PE=3 SV=1 | 119 | 364 | 3.0E-29 |
| sp|Q818X0|BIOF_BACCR | Putative 8-amino-7-oxononanoate synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=bioF PE=3 SV=1 | 119 | 364 | 4.0E-29 |
| sp|B7HAZ0|BIOF_BACC4 | Putative 8-amino-7-oxononanoate synthase OS=Bacillus cereus (strain B4264) GN=bioF PE=3 SV=1 | 119 | 364 | 4.0E-29 |
| sp|A0RIB9|BIOF_BACAH | Putative 8-amino-7-oxononanoate synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=bioF PE=3 SV=1 | 127 | 392 | 7.0E-29 |
| sp|A9VG56|BIOF_BACWK | Putative 8-amino-7-oxononanoate synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=bioF PE=3 SV=1 | 119 | 364 | 7.0E-29 |
| sp|Q39XE0|BIOF_GEOMG | 8-amino-7-oxononanoate synthase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=bioF PE=3 SV=2 | 109 | 364 | 1.0E-28 |
| sp|A8FDG9|BIOF_BACP2 | 8-amino-7-oxononanoate synthase OS=Bacillus pumilus (strain SAFR-032) GN=BPUM_1604 PE=3 SV=2 | 121 | 391 | 1.0E-28 |
| sp|Q5NZF5|BIOF_AROAE | 8-amino-7-oxononanoate synthase OS=Aromatoleum aromaticum (strain EbN1) GN=bioF PE=3 SV=1 | 112 | 422 | 1.0E-28 |
| sp|O66875|BIOF_AQUAE | Putative 8-amino-7-oxononanoate synthase OS=Aquifex aeolicus (strain VF5) GN=bioF PE=3 SV=1 | 125 | 391 | 2.0E-28 |
| sp|B1I4F9|BIOF_DESAP | Putative 8-amino-7-oxononanoate synthase OS=Desulforudis audaxviator (strain MP104C) GN=bioF PE=3 SV=1 | 112 | 421 | 3.0E-28 |
| sp|B5EEV8|BIOF_GEOBB | 8-amino-7-oxononanoate synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=bioF PE=3 SV=1 | 108 | 399 | 8.0E-28 |
| sp|A9HJ57|BIOF_GLUDA | 8-amino-7-oxononanoate synthase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=GDI1920 PE=3 SV=2 | 95 | 364 | 2.0E-27 |
| sp|P53556|BIOF2_BACSU | 8-amino-7-oxononanoate synthase 2 OS=Bacillus subtilis (strain 168) GN=bioF PE=1 SV=1 | 83 | 431 | 2.0E-27 |
| sp|Q9K625|BIOF_BACHD | Putative 8-amino-7-oxononanoate synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bioF PE=3 SV=1 | 125 | 399 | 3.0E-27 |
| sp|Q58694|BIOF_METJA | Putative 8-amino-7-oxononanoate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=bioF PE=3 SV=1 | 145 | 394 | 3.0E-27 |
| sp|Q3M9A4|BIOF_ANAVT | Putative 8-amino-7-oxononanoate synthase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=bioF PE=3 SV=1 | 109 | 399 | 4.0E-27 |
| sp|A4G5N9|BIOF_HERAR | 8-amino-7-oxononanoate synthase OS=Herminiimonas arsenicoxydans GN=bioF PE=3 SV=1 | 112 | 414 | 5.0E-27 |
| sp|Q8KZM9|BIOF_BACNA | Putative 8-amino-7-oxononanoate synthase OS=Bacillus subtilis subsp. natto GN=bioF PE=3 SV=1 | 121 | 380 | 9.0E-27 |
| sp|B3QLR6|BIOF_CHLP8 | 8-amino-7-oxononanoate synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=Cpar_2015 PE=3 SV=2 | 106 | 367 | 9.0E-27 |
| sp|Q119K2|BIOF_TRIEI | Putative 8-amino-7-oxononanoate synthase OS=Trichodesmium erythraeum (strain IMS101) GN=bioF PE=3 SV=1 | 114 | 425 | 1.0E-26 |
| sp|P74770|BIOF_SYNY3 | Putative 8-amino-7-oxononanoate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=bioF PE=3 SV=2 | 98 | 417 | 2.0E-26 |
| sp|B9M8U3|BIOF_GEODF | 8-amino-7-oxononanoate synthase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=bioF PE=3 SV=1 | 121 | 370 | 2.0E-26 |
| sp|A7Z5B4|BIOF2_BACMF | Putative 8-amino-7-oxononanoate synthase 2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=bioF PE=3 SV=1 | 120 | 421 | 3.0E-26 |
| sp|Q5SHZ8|BIKB_THET8 | 8-amino-7-oxononanoate synthase/2-amino-3-ketobutyrate coenzyme A ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA1582 PE=1 SV=1 | 108 | 399 | 3.0E-26 |
| sp|A6UWX3|BIOF_META3 | Putative 8-amino-7-oxononanoate synthase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=bioF PE=3 SV=1 | 127 | 364 | 8.0E-26 |
| sp|Q31E54|BIOF_THICR | 8-amino-7-oxononanoate synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=bioF PE=3 SV=1 | 90 | 393 | 8.0E-26 |
| sp|B8HTV6|BIOF_CYAP4 | Putative 8-amino-7-oxononanoate synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=bioF PE=3 SV=1 | 109 | 399 | 9.0E-26 |
| sp|O88986|KBL_MOUSE | 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial OS=Mus musculus GN=Gcat PE=1 SV=2 | 108 | 457 | 1.0E-25 |
| sp|P37419|KBL_SALTY | 2-amino-3-ketobutyrate coenzyme A ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=kbl PE=3 SV=2 | 108 | 434 | 2.0E-25 |
| sp|Q81ZZ4|BIOF_NITEU | 8-amino-7-oxononanoate synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=bioF PE=3 SV=1 | 98 | 378 | 2.0E-25 |
| sp|B7K0L9|BIOF_CYAP8 | Putative 8-amino-7-oxononanoate synthase OS=Cyanothece sp. (strain PCC 8801) GN=bioF PE=3 SV=1 | 121 | 438 | 3.0E-25 |
| sp|A7HP29|BIOF_PARL1 | Putative 8-amino-7-oxononanoate synthase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=bioF PE=3 SV=2 | 117 | 421 | 4.0E-25 |
| sp|Q0P5L8|KBL_BOVIN | 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial OS=Bos taurus GN=GCAT PE=1 SV=1 | 108 | 457 | 4.0E-25 |
| sp|P0AB79|KBL_SHIFL | 2-amino-3-ketobutyrate coenzyme A ligase OS=Shigella flexneri GN=kbl PE=3 SV=1 | 108 | 434 | 5.0E-25 |
| sp|P0AB77|KBL_ECOLI | 2-amino-3-ketobutyrate coenzyme A ligase OS=Escherichia coli (strain K12) GN=kbl PE=1 SV=1 | 108 | 434 | 5.0E-25 |
| sp|P0AB78|KBL_ECO57 | 2-amino-3-ketobutyrate coenzyme A ligase OS=Escherichia coli O157:H7 GN=kbl PE=3 SV=1 | 108 | 434 | 5.0E-25 |
| sp|Q21FY4|BIOF_SACD2 | 8-amino-7-oxononanoate synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=bioF PE=3 SV=1 | 92 | 422 | 7.0E-25 |
| sp|B1YMC6|BIOF_EXIS2 | 8-amino-7-oxononanoate synthase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=Exig_1033 PE=3 SV=1 | 121 | 418 | 8.0E-25 |
| sp|B0JQZ0|BIOF_MICAN | Putative 8-amino-7-oxononanoate synthase OS=Microcystis aeruginosa (strain NIES-843) GN=bioF PE=3 SV=1 | 105 | 415 | 1.0E-24 |
| sp|B2J1W1|BIOF_NOSP7 | Putative 8-amino-7-oxononanoate synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=bioF PE=3 SV=1 | 109 | 399 | 7.0E-24 |
| sp|Q7W9I4|BIOF_BORPA | Putative 8-amino-7-oxononanoate synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=bioF PE=3 SV=1 | 121 | 364 | 8.0E-24 |
| sp|Q1DCV8|BIOF_MYXXD | 8-amino-7-oxononanoate synthase OS=Myxococcus xanthus (strain DK 1622) GN=bioF PE=3 SV=1 | 112 | 393 | 9.0E-24 |
| sp|A4SPR6|BIOF_AERS4 | 8-amino-7-oxononanoate synthase OS=Aeromonas salmonicida (strain A449) GN=bioF PE=3 SV=1 | 111 | 399 | 9.0E-24 |
| sp|A0KIC7|BIOF_AERHH | 8-amino-7-oxononanoate synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=bioF PE=3 SV=1 | 111 | 399 | 1.0E-23 |
| sp|Q3J9D6|BIOF_NITOC | 8-amino-7-oxononanoate synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=bioF PE=3 SV=1 | 108 | 399 | 2.0E-23 |
| sp|O75600|KBL_HUMAN | 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial OS=Homo sapiens GN=GCAT PE=1 SV=1 | 108 | 499 | 4.0E-23 |
| sp|A0L3L7|BIOF_MAGMM | Putative 8-amino-7-oxononanoate synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=bioF PE=3 SV=1 | 119 | 364 | 6.0E-23 |
| sp|Q3A3Z8|BIOF_PELCD | Putative 8-amino-7-oxononanoate synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=bioF PE=3 SV=1 | 119 | 364 | 7.0E-23 |
| sp|A2SD53|BIOF_METPP | 8-amino-7-oxononanoate synthase OS=Methylibium petroleiphilum (strain PM1) GN=bioF PE=3 SV=1 | 128 | 381 | 9.0E-23 |
| sp|Q47C04|BIOF_DECAR | 8-amino-7-oxononanoate synthase OS=Dechloromonas aromatica (strain RCB) GN=bioF PE=3 SV=1 | 121 | 414 | 1.0E-22 |
| sp|A1K6Q1|BIOF_AZOSB | 8-amino-7-oxononanoate synthase OS=Azoarcus sp. (strain BH72) GN=bioF PE=3 SV=1 | 112 | 360 | 2.0E-22 |
| sp|Q7VWP1|BIOF_BORPE | Putative 8-amino-7-oxononanoate synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=bioF PE=3 SV=1 | 121 | 364 | 2.0E-22 |
| sp|Q7WH76|BIOF_BORBR | Putative 8-amino-7-oxononanoate synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=bioF PE=3 SV=1 | 121 | 364 | 2.0E-22 |
| sp|B2IH50|BIOF_BEII9 | 8-amino-7-oxononanoate synthase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=Bind_0814 PE=3 SV=1 | 121 | 421 | 2.0E-22 |
| sp|Q2Y9Y8|BIOF_NITMU | 8-amino-7-oxononanoate synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=bioF PE=3 SV=1 | 112 | 421 | 3.0E-22 |
| sp|P78698|HEM1_KLULA | 5-aminolevulinate synthase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HEM1 PE=3 SV=2 | 125 | 439 | 3.0E-22 |
| sp|A6UQL9|BIOF_METVS | Putative 8-amino-7-oxononanoate synthase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=bioF PE=3 SV=1 | 125 | 412 | 3.0E-22 |
| sp|A1U4B1|BIOF_MARHV | 8-amino-7-oxononanoate synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=bioF PE=3 SV=1 | 108 | 381 | 3.0E-22 |
| sp|B4UCB1|BIOF_ANASK | 8-amino-7-oxononanoate synthase OS=Anaeromyxobacter sp. (strain K) GN=bioF PE=3 SV=1 | 110 | 348 | 7.0E-22 |
| sp|B8J637|BIOF_ANAD2 | 8-amino-7-oxononanoate synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=bioF PE=3 SV=1 | 110 | 348 | 1.0E-21 |
| sp|Q0A5W2|BIOF_ALKEH | 8-amino-7-oxononanoate synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=bioF PE=3 SV=1 | 120 | 395 | 1.0E-21 |
| sp|Q2IF62|BIOF_ANADE | 8-amino-7-oxononanoate synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=bioF PE=3 SV=1 | 85 | 360 | 2.0E-21 |
| sp|A7HG96|BIOF_ANADF | 8-amino-7-oxononanoate synthase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=bioF PE=3 SV=1 | 109 | 359 | 2.0E-21 |
| sp|Q8YZT3|BIOF_NOSS1 | Putative 8-amino-7-oxononanoate synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=bioF PE=3 SV=1 | 109 | 400 | 3.0E-21 |
| sp|Q0BUV6|BIOF_GRABC | 8-amino-7-oxononanoate synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=GbCGDNIH1_0498 PE=3 SV=2 | 123 | 421 | 4.0E-21 |
| sp|A8ZUS7|BIOF_DESOH | Putative 8-amino-7-oxononanoate synthase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=bioF PE=3 SV=1 | 110 | 364 | 5.0E-21 |
| sp|Q1GZA7|BIOF_METFK | 8-amino-7-oxononanoate synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=bioF PE=3 SV=2 | 108 | 322 | 6.0E-21 |
| sp|B3PI88|BIOF_CELJU | 8-amino-7-oxononanoate synthase OS=Cellvibrio japonicus (strain Ueda107) GN=bioF PE=3 SV=2 | 112 | 380 | 7.0E-21 |
| sp|Q8DJ97|BIOF_THEEB | Putative 8-amino-7-oxononanoate synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=bioF PE=3 SV=1 | 123 | 384 | 1.0E-20 |
| sp|B7VH15|BIOF_VIBTL | 8-amino-7-oxononanoate synthase OS=Vibrio tasmaniensis (strain LGP32) GN=bioF PE=3 SV=2 | 99 | 380 | 1.0E-20 |
| sp|B8F713|BIOF_HAEPS | Putative 8-amino-7-oxononanoate synthase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=bioF PE=3 SV=1 | 116 | 418 | 2.0E-20 |
| sp|B5YFU5|BIOF_THEYD | Putative 8-amino-7-oxononanoate synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=bioF PE=3 SV=1 | 122 | 392 | 2.0E-20 |
| sp|Q5DZH9|BIOF_VIBF1 | 8-amino-7-oxononanoate synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=bioF PE=3 SV=2 | 121 | 379 | 4.0E-20 |
| sp|A4VR87|BIOF_PSEU5 | 8-amino-7-oxononanoate synthase OS=Pseudomonas stutzeri (strain A1501) GN=bioF PE=3 SV=1 | 107 | 441 | 6.0E-20 |
| sp|Q75DX7|HEM1_ASHGO | 5-aminolevulinate synthase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HEM1 PE=3 SV=1 | 118 | 372 | 1.0E-19 |
| sp|Q9CJU0|BIOF_PASMU | Putative 8-amino-7-oxononanoate synthase OS=Pasteurella multocida (strain Pm70) GN=bioF PE=3 SV=1 | 124 | 364 | 2.0E-19 |
| sp|A7MX30|BIOF_VIBCB | 8-amino-7-oxononanoate synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=bioF PE=3 SV=1 | 122 | 400 | 2.0E-19 |
| sp|Q2SBD5|BIOF_HAHCH | 8-amino-7-oxononanoate synthase OS=Hahella chejuensis (strain KCTC 2396) GN=bioF PE=3 SV=1 | 109 | 371 | 3.0E-19 |
| sp|Q2W3L2|BIOF_MAGSA | Putative 8-amino-7-oxononanoate synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=bioF PE=3 SV=1 | 107 | 364 | 3.0E-19 |
| sp|B5EUP9|BIOF_VIBFM | 8-amino-7-oxononanoate synthase OS=Vibrio fischeri (strain MJ11) GN=bioF PE=3 SV=1 | 121 | 379 | 4.0E-19 |
| sp|Q9XS79|HEM1_DELLE | 5-aminolevulinate synthase, nonspecific, mitochondrial OS=Delphinapterus leucas GN=ALAS1 PE=2 SV=1 | 119 | 410 | 4.0E-19 |
| sp|B0SZS9|BIOF_CAUSK | Putative 8-amino-7-oxononanoate synthase OS=Caulobacter sp. (strain K31) GN=bioF PE=3 SV=1 | 121 | 360 | 5.0E-19 |
| sp|Q87QN5|BIOF_VIBPA | 8-amino-7-oxononanoate synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=bioF PE=3 SV=2 | 122 | 379 | 5.0E-19 |
| sp|B6ESC6|BIOF_ALISL | 8-amino-7-oxononanoate synthase OS=Aliivibrio salmonicida (strain LFI1238) GN=bioF PE=3 SV=1 | 91 | 379 | 6.0E-19 |
| sp|Q7NPW2|BIOF_CHRVO | 8-amino-7-oxononanoate synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=bioF PE=3 SV=1 | 112 | 392 | 7.0E-19 |
| sp|B2VBT8|BIOF_ERWT9 | 8-amino-7-oxononanoate synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=bioF PE=3 SV=1 | 112 | 418 | 9.0E-19 |
| sp|Q7MLU9|BIOF_VIBVY | 8-amino-7-oxononanoate synthase OS=Vibrio vulnificus (strain YJ016) GN=bioF PE=3 SV=1 | 116 | 380 | 1.0E-18 |
| sp|P13195|HEM1_RAT | 5-aminolevulinate synthase, nonspecific, mitochondrial OS=Rattus norvegicus GN=Alas1 PE=2 SV=2 | 147 | 399 | 2.0E-18 |
| sp|Q9YHT4|HEM0_DANRE | 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Danio rerio GN=alas2 PE=2 SV=1 | 145 | 410 | 2.0E-18 |
| sp|Q92G23|HEM1_RICCN | 5-aminolevulinate synthase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=hemA PE=3 SV=2 | 146 | 383 | 4.0E-18 |
| sp|B4ESU4|BIOF_PROMH | 8-amino-7-oxononanoate synthase OS=Proteus mirabilis (strain HI4320) GN=bioF PE=3 SV=1 | 117 | 438 | 4.0E-18 |
| sp|Q0AE73|BIOF_NITEC | 8-amino-7-oxononanoate synthase OS=Nitrosomonas eutropha (strain C91) GN=bioF PE=3 SV=1 | 108 | 360 | 5.0E-18 |
| sp|Q3K5P2|BIOF_PSEPF | 8-amino-7-oxononanoate synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=bioF PE=3 SV=1 | 107 | 444 | 5.0E-18 |
| sp|Q9KSZ3|BIOF_VIBCH | 8-amino-7-oxononanoate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=bioF PE=3 SV=1 | 123 | 381 | 6.0E-18 |
| sp|A5UCE4|BIOF_HAEIE | Putative 8-amino-7-oxononanoate synthase OS=Haemophilus influenzae (strain PittEE) GN=bioF PE=3 SV=1 | 119 | 398 | 8.0E-18 |
| sp|Q8D8N0|BIOF_VIBVU | 8-amino-7-oxononanoate synthase OS=Vibrio vulnificus (strain CMCP6) GN=bioF PE=3 SV=1 | 116 | 380 | 8.0E-18 |
| sp|Q4UJV4|HEM1_RICFE | 5-aminolevulinate synthase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hemA PE=3 SV=1 | 141 | 383 | 8.0E-18 |
| sp|B3EAE0|BIOF_GEOLS | 8-amino-7-oxononanoate synthase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=bioF PE=3 SV=1 | 113 | 364 | 9.0E-18 |
| sp|A9BV10|BIOF_DELAS | 8-amino-7-oxononanoate synthase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=bioF PE=3 SV=1 | 121 | 405 | 1.0E-17 |
| sp|Q9ZCB8|HEM1_RICPR | 5-aminolevulinate synthase OS=Rickettsia prowazekii (strain Madrid E) GN=hemA PE=3 SV=1 | 141 | 383 | 1.0E-17 |
| sp|P44422|BIOF_HAEIN | Putative 8-amino-7-oxononanoate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bioF PE=3 SV=1 | 122 | 398 | 1.0E-17 |
| sp|A4T9L3|BIOF_MYCGI | 8-amino-7-oxononanoate synthase OS=Mycobacterium gilvum (strain PYR-GCK) GN=Mflv_3628 PE=3 SV=1 | 124 | 382 | 2.0E-17 |
| sp|Q0APZ9|BIOF_MARMM | 8-amino-7-oxononanoate synthase OS=Maricaulis maris (strain MCS10) GN=bioF PE=3 SV=1 | 112 | 364 | 2.0E-17 |
| sp|Q4K4T3|BIOF_PSEF5 | 8-amino-7-oxononanoate synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=bioF PE=3 SV=1 | 107 | 444 | 2.0E-17 |
| sp|Q0VMD1|BIOF_ALCBS | 8-amino-7-oxononanoate synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=bioF PE=3 SV=1 | 108 | 368 | 2.0E-17 |
| sp|A1VUJ6|BIOF_POLNA | 8-amino-7-oxononanoate synthase OS=Polaromonas naphthalenivorans (strain CJ2) GN=bioF PE=3 SV=2 | 112 | 378 | 3.0E-17 |
| sp|Q1RIV2|HEM1_RICBR | 5-aminolevulinate synthase OS=Rickettsia bellii (strain RML369-C) GN=hemA PE=3 SV=1 | 144 | 432 | 4.0E-17 |
| sp|Q6A6M4|BIOWF_PROAC | Biotin biosynthesis bifunctional protein BioWF OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=PPA1866 PE=3 SV=1 | 128 | 362 | 5.0E-17 |
| sp|A1KVF6|BIOF_NEIMF | Putative 8-amino-7-oxononanoate synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=bioF PE=3 SV=1 | 122 | 364 | 5.0E-17 |
| sp|P26505|HEM1_RHIRD | 5-aminolevulinate synthase OS=Rhizobium radiobacter GN=hemA PE=3 SV=1 | 120 | 432 | 5.0E-17 |
| sp|A5UJ44|BIOF_HAEIG | Putative 8-amino-7-oxononanoate synthase OS=Haemophilus influenzae (strain PittGG) GN=bioF PE=3 SV=1 | 119 | 364 | 7.0E-17 |
| sp|Q4QKR3|BIOF_HAEI8 | Putative 8-amino-7-oxononanoate synthase OS=Haemophilus influenzae (strain 86-028NP) GN=bioF PE=3 SV=1 | 119 | 364 | 7.0E-17 |
| sp|D4H9Y2|BIOWF_PROAS | Biotin biosynthesis bifunctional protein BioWF OS=Propionibacterium acnes (strain SK137) GN=HMPREF0675_4919 PE=3 SV=1 | 128 | 362 | 8.0E-17 |
| sp|A6W0Y0|BIOF_MARMS | 8-amino-7-oxononanoate synthase OS=Marinomonas sp. (strain MWYL1) GN=bioF PE=3 SV=1 | 112 | 380 | 9.0E-17 |
| sp|P43090|HEM0_OPSTA | 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Opsanus tau GN=alas2 PE=2 SV=1 | 122 | 410 | 9.0E-17 |
| sp|A6QLI6|HEM1_BOVIN | 5-aminolevulinate synthase, nonspecific, mitochondrial OS=Bos taurus GN=ALAS1 PE=2 SV=1 | 119 | 410 | 1.0E-16 |
| sp|Q68VS3|HEM1_RICTY | 5-aminolevulinate synthase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=hemA PE=3 SV=1 | 141 | 383 | 1.0E-16 |
| sp|Q9K0U0|BIOF_NEIMB | Putative 8-amino-7-oxononanoate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=bioF PE=3 SV=1 | 122 | 364 | 1.0E-16 |
| sp|B4RP93|BIOF_NEIG2 | Putative 8-amino-7-oxononanoate synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=bioF PE=3 SV=1 | 122 | 364 | 1.0E-16 |
| sp|A9MTI7|BIOF_SALPB | 8-amino-7-oxononanoate synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=bioF PE=3 SV=1 | 109 | 381 | 1.0E-16 |
| sp|Q5F6R6|BIOF_NEIG1 | Putative 8-amino-7-oxononanoate synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=bioF PE=3 SV=1 | 122 | 364 | 1.0E-16 |
| sp|Q7N6Q6|BIOF_PHOLL | 8-amino-7-oxononanoate synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=bioF PE=3 SV=1 | 127 | 398 | 1.0E-16 |
| sp|B8GTH6|BIOF_THISH | 8-amino-7-oxononanoate synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=bioF PE=3 SV=1 | 95 | 440 | 2.0E-16 |
| sp|Q609V1|BIOF_METCA | 8-amino-7-oxononanoate synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=bioF PE=3 SV=1 | 121 | 368 | 2.0E-16 |
| sp|Q6FXE3|HEM1_CANGA | 5-aminolevulinate synthase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HEM1 PE=3 SV=1 | 125 | 439 | 2.0E-16 |
| sp|Q8Z892|BIOF_SALTI | 8-amino-7-oxononanoate synthase OS=Salmonella typhi GN=bioF PE=3 SV=1 | 109 | 381 | 2.0E-16 |
| sp|B5R762|BIOF_SALG2 | 8-amino-7-oxononanoate synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=bioF PE=3 SV=1 | 109 | 381 | 2.0E-16 |
| sp|B5QX66|BIOF_SALEP | 8-amino-7-oxononanoate synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=bioF PE=3 SV=1 | 109 | 381 | 2.0E-16 |
| sp|P22557|HEM0_HUMAN | 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Homo sapiens GN=ALAS2 PE=1 SV=2 | 123 | 402 | 2.0E-16 |
| sp|B4TQU0|BIOF_SALSV | 8-amino-7-oxononanoate synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=bioF PE=3 SV=1 | 109 | 381 | 3.0E-16 |
| sp|Q8ZQQ7|BIOF_SALTY | 8-amino-7-oxononanoate synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=bioF PE=3 SV=1 | 109 | 381 | 3.0E-16 |
| sp|B4TC49|BIOF_SALHS | 8-amino-7-oxononanoate synthase OS=Salmonella heidelberg (strain SL476) GN=bioF PE=3 SV=1 | 109 | 381 | 3.0E-16 |
| sp|Q5R557|HEM0_PONAB | 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Pongo abelii GN=ALAS2 PE=2 SV=1 | 123 | 379 | 3.0E-16 |
| sp|Q89AK6|BIOF_BUCBP | 8-amino-7-oxononanoate synthase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=bioF PE=3 SV=1 | 121 | 418 | 3.0E-16 |
| sp|Q57RG2|BIOF_SALCH | 8-amino-7-oxononanoate synthase OS=Salmonella choleraesuis (strain SC-B67) GN=bioF PE=3 SV=1 | 109 | 381 | 3.0E-16 |
| sp|A7MJ02|BIOF_CROS8 | 8-amino-7-oxononanoate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=bioF PE=3 SV=1 | 99 | 397 | 3.0E-16 |
| sp|B1JE54|BIOF_PSEPW | 8-amino-7-oxononanoate synthase OS=Pseudomonas putida (strain W619) GN=bioF PE=3 SV=1 | 107 | 379 | 3.0E-16 |
| sp|Q1I3N7|BIOF_PSEE4 | 8-amino-7-oxononanoate synthase OS=Pseudomonas entomophila (strain L48) GN=bioF PE=3 SV=1 | 107 | 441 | 3.0E-16 |
| sp|B2AG98|BIOF_CUPTR | 8-amino-7-oxononanoate synthase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=bioF PE=3 SV=1 | 124 | 405 | 3.0E-16 |
| sp|A1ITK1|BIOF_NEIMA | Putative 8-amino-7-oxononanoate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=bioF PE=3 SV=1 | 165 | 364 | 3.0E-16 |
| sp|A9M251|BIOF_NEIM0 | Putative 8-amino-7-oxononanoate synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=bioF PE=3 SV=2 | 165 | 364 | 3.0E-16 |
| sp|B5BC30|BIOF_SALPK | 8-amino-7-oxononanoate synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=bioF PE=3 SV=1 | 109 | 381 | 3.0E-16 |
| sp|Q5PG49|BIOF_SALPA | 8-amino-7-oxononanoate synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=bioF PE=3 SV=1 | 109 | 381 | 3.0E-16 |
| sp|A1AQT1|BIOF_PELPD | 8-amino-7-oxononanoate synthase OS=Pelobacter propionicus (strain DSM 2379) GN=bioF PE=3 SV=1 | 108 | 399 | 4.0E-16 |
| sp|Q9XT75|HEM0_DELLE | 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Delphinapterus leucas GN=ALAS2 PE=2 SV=1 | 123 | 402 | 4.0E-16 |
| sp|C0PWY3|BIOF_SALPC | 8-amino-7-oxononanoate synthase OS=Salmonella paratyphi C (strain RKS4594) GN=bioF PE=3 SV=1 | 109 | 381 | 4.0E-16 |
| sp|B5F073|BIOF_SALA4 | 8-amino-7-oxononanoate synthase OS=Salmonella agona (strain SL483) GN=bioF PE=3 SV=1 | 109 | 381 | 4.0E-16 |
| sp|Q9A7Z1|BIOF_CAUCR | Putative 8-amino-7-oxononanoate synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=bioF PE=3 SV=2 | 121 | 360 | 6.0E-16 |
| sp|B8GVE2|BIOF_CAUCN | Putative 8-amino-7-oxononanoate synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=bioF PE=3 SV=1 | 121 | 360 | 6.0E-16 |
| sp|O94069|HEM1_CANAL | 5-aminolevulinate synthase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HEM1 PE=3 SV=1 | 125 | 414 | 6.0E-16 |
| sp|Q146K3|BIOF_BURXL | 8-amino-7-oxononanoate synthase OS=Burkholderia xenovorans (strain LB400) GN=bioF PE=3 SV=1 | 121 | 372 | 6.0E-16 |
| sp|Q6BX71|HEM1_DEBHA | 5-aminolevulinate synthase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HEM1 PE=3 SV=1 | 125 | 399 | 8.0E-16 |
| sp|A1T8U6|BIOF_MYCVP | 8-amino-7-oxononanoate synthase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=Mvan_2789 PE=3 SV=1 | 127 | 382 | 8.0E-16 |
| sp|B0KJ54|BIOF_PSEPG | 8-amino-7-oxononanoate synthase OS=Pseudomonas putida (strain GB-1) GN=bioF PE=3 SV=1 | 107 | 379 | 9.0E-16 |
| sp|A1TTV0|BIOF_ACIAC | 8-amino-7-oxononanoate synthase OS=Acidovorax citrulli (strain AAC00-1) GN=bioF PE=3 SV=1 | 121 | 401 | 9.0E-16 |
| sp|Q48CS2|BIOF_PSE14 | 8-amino-7-oxononanoate synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=bioF PE=3 SV=1 | 95 | 380 | 1.0E-15 |
| sp|Q3ZC31|HEM0_BOVIN | 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Bos taurus GN=ALAS2 PE=2 SV=1 | 123 | 402 | 2.0E-15 |
| sp|B4SZJ8|BIOF_SALNS | 8-amino-7-oxononanoate synthase OS=Salmonella newport (strain SL254) GN=bioF PE=3 SV=1 | 109 | 381 | 2.0E-15 |
| sp|B5FP62|BIOF_SALDC | 8-amino-7-oxononanoate synthase OS=Salmonella dublin (strain CT_02021853) GN=bioF PE=3 SV=1 | 109 | 381 | 2.0E-15 |
| sp|Q8GW43|BIOF_ARATH | 8-amino-7-oxononanoate synthase OS=Arabidopsis thaliana GN=BIOF PE=1 SV=2 | 132 | 364 | 2.0E-15 |
| sp|Q1B7F0|BIOF_MYCSS | 8-amino-7-oxononanoate synthase OS=Mycobacterium sp. (strain MCS) GN=Mmcs_3077 PE=3 SV=1 | 122 | 382 | 3.0E-15 |
| sp|A1UHM3|BIOF_MYCSK | 8-amino-7-oxononanoate synthase OS=Mycobacterium sp. (strain KMS) GN=Mkms_3137 PE=3 SV=1 | 122 | 382 | 3.0E-15 |
| sp|Q63147|HEM0_RAT | 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Rattus norvegicus GN=Alas2 PE=1 SV=1 | 121 | 402 | 3.0E-15 |
| sp|P08680|HEM0_MOUSE | 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Mus musculus GN=Alas2 PE=1 SV=3 | 148 | 402 | 3.0E-15 |
| sp|Q1QYD6|BIOF_CHRSD | 8-amino-7-oxononanoate synthase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=bioF PE=3 SV=1 | 119 | 390 | 3.0E-15 |
| sp|Q4ZMA9|BIOF_PSEU2 | 8-amino-7-oxononanoate synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=bioF PE=3 SV=1 | 107 | 380 | 3.0E-15 |
| sp|A3Q146|BIOF_MYCSJ | 8-amino-7-oxononanoate synthase OS=Mycobacterium sp. (strain JLS) GN=Mjls_3094 PE=3 SV=1 | 122 | 382 | 4.0E-15 |
| sp|A9MJE5|BIOF_SALAR | 8-amino-7-oxononanoate synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=bioF PE=3 SV=1 | 109 | 381 | 5.0E-15 |
| sp|Q12F38|BIOF1_POLSJ | 8-amino-7-oxononanoate synthase 1 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=bioF1 PE=3 SV=1 | 121 | 310 | 5.0E-15 |
| sp|Q88A97|BIOF_PSESM | 8-amino-7-oxononanoate synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=bioF PE=3 SV=1 | 107 | 380 | 5.0E-15 |
| sp|Q6LPR3|BIOF_PHOPR | 8-amino-7-oxononanoate synthase OS=Photobacterium profundum GN=bioF PE=3 SV=2 | 122 | 381 | 7.0E-15 |
| sp|P13196|HEM1_HUMAN | 5-aminolevulinate synthase, nonspecific, mitochondrial OS=Homo sapiens GN=ALAS1 PE=1 SV=2 | 147 | 410 | 8.0E-15 |
| sp|C4LK80|BIOWF_CORK4 | Biotin biosynthesis bifunctional protein BioWF OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=bioWF PE=3 SV=1 | 115 | 399 | 8.0E-15 |
| sp|Q5R9R9|HEM1_PONAB | 5-aminolevulinate synthase, nonspecific, mitochondrial OS=Pongo abelii GN=ALAS1 PE=2 SV=1 | 147 | 410 | 9.0E-15 |
| sp|A4XZR8|BIOF_PSEMY | 8-amino-7-oxononanoate synthase OS=Pseudomonas mendocina (strain ymp) GN=bioF PE=3 SV=1 | 107 | 441 | 1.0E-14 |
| sp|P07997|HEM1_CHICK | 5-aminolevulinate synthase, nonspecific, mitochondrial OS=Gallus gallus GN=ALAS1 PE=2 SV=2 | 147 | 410 | 1.0E-14 |
| sp|Q3Z408|BIOF_SHISS | 8-amino-7-oxononanoate synthase OS=Shigella sonnei (strain Ss046) GN=bioF PE=3 SV=1 | 119 | 327 | 1.0E-14 |
| sp|Q83S45|BIOF_SHIFL | 8-amino-7-oxononanoate synthase OS=Shigella flexneri GN=bioF PE=3 SV=1 | 119 | 327 | 1.0E-14 |
| sp|Q0T6I4|BIOF_SHIF8 | 8-amino-7-oxononanoate synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=bioF PE=3 SV=1 | 119 | 327 | 1.0E-14 |
| sp|B2SWS7|BIOF_BURPP | 8-amino-7-oxononanoate synthase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=bioF PE=3 SV=1 | 121 | 372 | 2.0E-14 |
| sp|P08262|HEM1_BRADU | 5-aminolevulinate synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hemA PE=3 SV=2 | 123 | 381 | 2.0E-14 |
| sp|Q2T1Q2|BIOF_BURTA | 8-amino-7-oxononanoate synthase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=bioF PE=3 SV=1 | 121 | 381 | 2.0E-14 |
| sp|Q04512|HEM1_RHOS4 | 5-aminolevulinate synthase 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=hemA PE=3 SV=1 | 148 | 399 | 2.0E-14 |
| sp|B7NA75|BIOF_ECOLU | 8-amino-7-oxononanoate synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=bioF PE=3 SV=1 | 132 | 381 | 2.0E-14 |
| sp|Q88QX1|BIOF_PSEPK | 8-amino-7-oxononanoate synthase OS=Pseudomonas putida (strain KT2440) GN=bioF PE=3 SV=1 | 107 | 379 | 2.0E-14 |
| sp|B6I7T0|BIOF_ECOSE | 8-amino-7-oxononanoate synthase OS=Escherichia coli (strain SE11) GN=bioF PE=3 SV=1 | 119 | 327 | 3.0E-14 |
| sp|A7ZJI5|BIOF_ECO24 | 8-amino-7-oxononanoate synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=bioF PE=3 SV=1 | 119 | 327 | 3.0E-14 |
| sp|P12998|BIOF_ECOLI | 8-amino-7-oxononanoate synthase OS=Escherichia coli (strain K12) GN=bioF PE=1 SV=1 | 119 | 381 | 3.0E-14 |
| sp|B1X7A6|BIOF_ECODH | 8-amino-7-oxononanoate synthase OS=Escherichia coli (strain K12 / DH10B) GN=bioF PE=3 SV=1 | 119 | 381 | 3.0E-14 |
| sp|A6UYW1|BIOF_PSEA7 | 8-amino-7-oxononanoate synthase OS=Pseudomonas aeruginosa (strain PA7) GN=bioF PE=3 SV=1 | 107 | 379 | 3.0E-14 |
| sp|B1IXJ2|BIOF_ECOLC | 8-amino-7-oxononanoate synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=bioF PE=3 SV=1 | 119 | 381 | 3.0E-14 |
| sp|A7ZY32|BIOF_ECOHS | 8-amino-7-oxononanoate synthase OS=Escherichia coli O9:H4 (strain HS) GN=bioF PE=3 SV=1 | 119 | 381 | 3.0E-14 |
| sp|A0QX65|BIOF_MYCS2 | 8-amino-7-oxononanoate synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=bioF PE=1 SV=1 | 127 | 416 | 4.0E-14 |
| sp|B5YRL5|BIOF_ECO5E | 8-amino-7-oxononanoate synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=bioF PE=3 SV=1 | 119 | 381 | 4.0E-14 |
| sp|Q8X823|BIOF_ECO57 | 8-amino-7-oxononanoate synthase OS=Escherichia coli O157:H7 GN=bioF PE=3 SV=3 | 119 | 381 | 4.0E-14 |
| sp|A6T6L6|BIOF_KLEP7 | 8-amino-7-oxononanoate synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=bioF PE=3 SV=1 | 122 | 381 | 4.0E-14 |
| sp|Q63Y23|BIOF_BURPS | 8-amino-7-oxononanoate synthase OS=Burkholderia pseudomallei (strain K96243) GN=bioF PE=3 SV=1 | 121 | 381 | 4.0E-14 |
| sp|A3N522|BIOF_BURP6 | 8-amino-7-oxononanoate synthase OS=Burkholderia pseudomallei (strain 668) GN=bioF PE=3 SV=1 | 121 | 381 | 4.0E-14 |
| sp|A3NQS3|BIOF_BURP0 | 8-amino-7-oxononanoate synthase OS=Burkholderia pseudomallei (strain 1106a) GN=bioF PE=3 SV=1 | 121 | 381 | 4.0E-14 |
| sp|A1V819|BIOF_BURMS | 8-amino-7-oxononanoate synthase OS=Burkholderia mallei (strain SAVP1) GN=bioF PE=3 SV=1 | 121 | 381 | 4.0E-14 |
| sp|Q62MX1|BIOF_BURMA | 8-amino-7-oxononanoate synthase OS=Burkholderia mallei (strain ATCC 23344) GN=bioF PE=3 SV=1 | 121 | 381 | 4.0E-14 |
| sp|A2S7R1|BIOF_BURM9 | 8-amino-7-oxononanoate synthase OS=Burkholderia mallei (strain NCTC 10229) GN=bioF PE=3 SV=1 | 121 | 381 | 4.0E-14 |
| sp|A3MNG3|BIOF_BURM7 | 8-amino-7-oxononanoate synthase OS=Burkholderia mallei (strain NCTC 10247) GN=bioF PE=3 SV=1 | 121 | 381 | 4.0E-14 |
| sp|B1LM67|BIOF_ECOSM | 8-amino-7-oxononanoate synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=bioF PE=3 SV=1 | 170 | 381 | 4.0E-14 |
| sp|B8ERL9|BIOF_METSB | 8-amino-7-oxononanoate synthase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=Msil_2132 PE=3 SV=1 | 119 | 399 | 4.0E-14 |
| sp|Q8VC19|HEM1_MOUSE | 5-aminolevulinate synthase, nonspecific, mitochondrial OS=Mus musculus GN=Alas1 PE=1 SV=2 | 147 | 399 | 5.0E-14 |
| sp|Q9I617|BIOF_PSEAE | 8-amino-7-oxononanoate synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bioF PE=3 SV=1 | 107 | 379 | 5.0E-14 |
| sp|Q02TR5|BIOF_PSEAB | 8-amino-7-oxononanoate synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=bioF PE=3 SV=1 | 107 | 379 | 5.0E-14 |
| sp|B7V486|BIOF_PSEA8 | 8-amino-7-oxononanoate synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=bioF PE=3 SV=1 | 107 | 379 | 5.0E-14 |
| sp|B7NNK6|BIOF_ECO7I | 8-amino-7-oxononanoate synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=bioF PE=3 SV=1 | 132 | 381 | 5.0E-14 |
| sp|B2JKH6|BIOF_BURP8 | 8-amino-7-oxononanoate synthase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=bioF PE=3 SV=1 | 121 | 372 | 6.0E-14 |
| sp|B7ULX3|BIOF_ECO27 | 8-amino-7-oxononanoate synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=bioF PE=3 SV=1 | 170 | 381 | 6.0E-14 |
| sp|Q324B6|BIOF_SHIBS | 8-amino-7-oxononanoate synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=bioF PE=3 SV=1 | 170 | 327 | 7.0E-14 |
| sp|B2TVF4|BIOF_SHIB3 | 8-amino-7-oxononanoate synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=bioF PE=3 SV=1 | 170 | 327 | 7.0E-14 |
| sp|Q0KF88|BIOF_CUPNH | 8-amino-7-oxononanoate synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=bioF PE=3 SV=1 | 120 | 405 | 7.0E-14 |
| sp|Q3JWR6|BIOF_BURP1 | 8-amino-7-oxononanoate synthase OS=Burkholderia pseudomallei (strain 1710b) GN=bioF PE=3 SV=2 | 121 | 381 | 8.0E-14 |
| sp|Q0TJS2|BIOF_ECOL5 | 8-amino-7-oxononanoate synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=bioF PE=3 SV=1 | 170 | 381 | 8.0E-14 |
| sp|B7MQM9|BIOF_ECO81 | 8-amino-7-oxononanoate synthase OS=Escherichia coli O81 (strain ED1a) GN=bioF PE=3 SV=1 | 170 | 381 | 8.0E-14 |
| sp|Q32I45|BIOF_SHIDS | 8-amino-7-oxononanoate synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=bioF PE=3 SV=1 | 119 | 381 | 9.0E-14 |
| sp|Q8FJQ2|BIOF_ECOL6 | 8-amino-7-oxononanoate synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=bioF PE=3 SV=1 | 170 | 381 | 9.0E-14 |
| sp|Q2NUJ6|BIOF_SODGM | 8-amino-7-oxononanoate synthase OS=Sodalis glossinidius (strain morsitans) GN=bioF PE=3 SV=1 | 164 | 375 | 9.0E-14 |
| sp|B7M748|BIOF_ECO8A | 8-amino-7-oxononanoate synthase OS=Escherichia coli O8 (strain IAI1) GN=bioF PE=3 SV=1 | 119 | 327 | 9.0E-14 |
| sp|Q1REF4|BIOF_ECOUT | 8-amino-7-oxononanoate synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=bioF PE=3 SV=1 | 170 | 381 | 1.0E-13 |
| sp|A1A918|BIOF_ECOK1 | 8-amino-7-oxononanoate synthase OS=Escherichia coli O1:K1 / APEC GN=bioF PE=3 SV=1 | 170 | 381 | 1.0E-13 |
| sp|B7MGN4|BIOF_ECO45 | 8-amino-7-oxononanoate synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=bioF PE=3 SV=1 | 170 | 381 | 1.0E-13 |
| sp|B8IBW2|BIOF_METNO | 8-amino-7-oxononanoate synthase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=Mnod_6357 PE=3 SV=1 | 121 | 383 | 1.0E-13 |
| sp|B7LC58|BIOF_ECO55 | 8-amino-7-oxononanoate synthase OS=Escherichia coli (strain 55989 / EAEC) GN=bioF PE=3 SV=1 | 119 | 327 | 2.0E-13 |
| sp|Q06965|HEM0_RHOS4 | 5-aminolevulinate synthase 2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=hemT PE=3 SV=1 | 111 | 391 | 2.0E-13 |
| sp|B7LJY7|BIOF_ESCF3 | 8-amino-7-oxononanoate synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=bioF PE=3 SV=1 | 170 | 327 | 2.0E-13 |
| sp|O14092|HEM1_SCHPO | 5-aminolevulinate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hem1 PE=3 SV=1 | 130 | 399 | 3.0E-13 |
| sp|A9HVE9|BIOF_BORPD | 8-amino-7-oxononanoate synthase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=bioF PE=3 SV=1 | 112 | 313 | 3.0E-13 |
| sp|Q6D3C0|BIOF_PECAS | 8-amino-7-oxononanoate synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=bioF PE=3 SV=1 | 123 | 418 | 3.0E-13 |
| sp|B1Y500|BIOF_LEPCP | 8-amino-7-oxononanoate synthase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=bioF PE=3 SV=1 | 120 | 399 | 4.0E-13 |
| sp|Q3SLX9|BIOF_THIDA | 8-amino-7-oxononanoate synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=bioF PE=3 SV=1 | 103 | 313 | 5.0E-13 |
| sp|P09950|HEM1_YEAST | 5-aminolevulinate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM1 PE=1 SV=1 | 125 | 409 | 7.0E-13 |
| sp|A5FZN8|BIOF_ACICJ | Putative 8-amino-7-oxononanoate synthase OS=Acidiphilium cryptum (strain JF-5) GN=bioF PE=3 SV=1 | 121 | 382 | 8.0E-13 |
| sp|P18079|HEM1_RHOCB | 5-aminolevulinate synthase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=hemA PE=1 SV=2 | 148 | 380 | 1.0E-12 |
| sp|A9W106|BIOF_METEP | 8-amino-7-oxononanoate synthase OS=Methylobacterium extorquens (strain PA1) GN=Mext_0857 PE=3 SV=1 | 121 | 358 | 2.0E-12 |
| sp|B7L0L2|BIOF_METC4 | 8-amino-7-oxononanoate synthase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=Mchl_0816 PE=3 SV=1 | 121 | 358 | 2.0E-12 |
| sp|A1WVM6|BIOF_HALHL | 8-amino-7-oxononanoate synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=bioF PE=3 SV=1 | 120 | 360 | 2.0E-12 |
| sp|P43091|HEM1_OPSTA | 5-aminolevulinate synthase, nonspecific, mitochondrial OS=Opsanus tau GN=alas1 PE=2 SV=1 | 119 | 410 | 4.0E-12 |
| sp|Q7VL09|BIOF_HAEDU | 8-amino-7-oxononanoate synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=HD_1684 PE=3 SV=1 | 119 | 363 | 7.0E-12 |
| sp|P43089|HEM1_PARDP | 5-aminolevulinate synthase OS=Paracoccus denitrificans (strain Pd 1222) GN=hemA PE=3 SV=2 | 148 | 399 | 8.0E-12 |
| sp|A6SU64|BIOF_JANMA | 8-amino-7-oxononanoate synthase OS=Janthinobacterium sp. (strain Marseille) GN=bioF PE=3 SV=1 | 112 | 368 | 1.0E-11 |
| sp|A0QHJ9|BIOF_MYCA1 | 8-amino-7-oxononanoate synthase OS=Mycobacterium avium (strain 104) GN=MAV_3205 PE=3 SV=1 | 124 | 382 | 1.0E-11 |
| sp|A8AJ11|BIOF_CITK8 | 8-amino-7-oxononanoate synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=bioF PE=3 SV=1 | 119 | 327 | 1.0E-11 |
| sp|A1JS67|BIOF_YERE8 | 8-amino-7-oxononanoate synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=bioF PE=3 SV=1 | 120 | 396 | 2.0E-11 |
| sp|Q740R7|BIOF_MYCPA | 8-amino-7-oxononanoate synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_1275 PE=3 SV=1 | 124 | 382 | 2.0E-11 |
| sp|Q92403|HEM1_AGABI | 5-aminolevulinate synthase, mitochondrial OS=Agaricus bisporus GN=hem1 PE=2 SV=1 | 130 | 364 | 3.0E-11 |
| sp|P36570|BIOF_SERMA | 8-amino-7-oxononanoate synthase OS=Serratia marcescens GN=bioF PE=3 SV=1 | 120 | 418 | 5.0E-11 |
| sp|A4W8B8|BIOF_ENT38 | 8-amino-7-oxononanoate synthase OS=Enterobacter sp. (strain 638) GN=bioF PE=3 SV=1 | 170 | 327 | 7.0E-11 |
| sp|Q66D66|BIOF_YERPS | 8-amino-7-oxononanoate synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=bioF PE=3 SV=1 | 120 | 364 | 8.0E-11 |
| sp|B2K8T1|BIOF_YERPB | 8-amino-7-oxononanoate synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=bioF PE=3 SV=1 | 120 | 364 | 8.0E-11 |
| sp|A4TNQ5|BIOF_YERPP | 8-amino-7-oxononanoate synthase OS=Yersinia pestis (strain Pestoides F) GN=bioF PE=3 SV=1 | 120 | 364 | 1.0E-10 |
| sp|Q1CFQ4|BIOF_YERPN | 8-amino-7-oxononanoate synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=bioF PE=3 SV=1 | 120 | 364 | 1.0E-10 |
| sp|A9R3C9|BIOF_YERPG | 8-amino-7-oxononanoate synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=bioF PE=3 SV=1 | 120 | 364 | 1.0E-10 |
| sp|Q7CH66|BIOF_YERPE | 8-amino-7-oxononanoate synthase OS=Yersinia pestis GN=bioF PE=3 SV=1 | 120 | 364 | 1.0E-10 |
| sp|Q1C946|BIOF_YERPA | 8-amino-7-oxononanoate synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=bioF PE=3 SV=1 | 120 | 364 | 1.0E-10 |
| sp|A5VXF2|BIOF_PSEP1 | 8-amino-7-oxononanoate synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=bioF PE=3 SV=1 | 107 | 399 | 1.0E-10 |
| sp|P08080|HEM1_RHIME | 5-aminolevulinate synthase OS=Rhizobium meliloti (strain 1021) GN=hemA PE=3 SV=2 | 112 | 402 | 1.0E-10 |
| sp|B1JSS3|BIOF_YERPY | 8-amino-7-oxononanoate synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=bioF PE=3 SV=1 | 120 | 364 | 1.0E-10 |
| sp|A7FKM8|BIOF_YERP3 | 8-amino-7-oxononanoate synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=bioF PE=3 SV=1 | 120 | 364 | 1.0E-10 |
| sp|B1Z7Y8|BIOF_METPB | 8-amino-7-oxononanoate synthase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=Mpop_0781 PE=3 SV=1 | 121 | 358 | 1.0E-10 |
| sp|Q7RVY5|HEM1_NEUCR | 5-aminolevulinate synthase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alv-1 PE=3 SV=2 | 132 | 364 | 2.0E-10 |
| sp|B2UBJ3|BIOF_RALPJ | 8-amino-7-oxononanoate synthase OS=Ralstonia pickettii (strain 12J) GN=bioF PE=3 SV=1 | 123 | 380 | 2.0E-10 |
| sp|P38092|HEM1_EMENI | 5-aminolevulinate synthase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hemA PE=3 SV=2 | 120 | 364 | 3.0E-10 |
| sp|Q47829|BIOF_ESCVU | 8-amino-7-oxononanoate synthase OS=Escherichia vulneris GN=bioF PE=3 SV=1 | 170 | 327 | 3.0E-10 |
| sp|A5WMQ5|BIOF_MYCTF | 8-amino-7-oxononanoate synthase OS=Mycobacterium tuberculosis (strain F11) GN=TBFG_11601 PE=3 SV=1 | 124 | 382 | 7.0E-10 |
| sp|A5U2S6|BIOF_MYCTA | 8-amino-7-oxononanoate synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1581 PE=3 SV=1 | 124 | 382 | 7.0E-10 |
| sp|A1KJ00|BIOF_MYCBP | 8-amino-7-oxononanoate synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1622 PE=3 SV=1 | 124 | 382 | 7.0E-10 |
| sp|P0A4X5|BIOF_MYCBO | 8-amino-7-oxononanoate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1596 PE=3 SV=1 | 124 | 382 | 7.0E-10 |
| sp|P9WQ87|BIOF1_MYCTU | 8-amino-7-oxononanoate synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bioF1 PE=1 SV=1 | 124 | 382 | 7.0E-10 |
| sp|P9WQ86|BIOF1_MYCTO | 8-amino-7-oxononanoate synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bioF1 PE=3 SV=1 | 124 | 382 | 7.0E-10 |
| sp|B5XZ74|BIOF_KLEP3 | 8-amino-7-oxononanoate synthase OS=Klebsiella pneumoniae (strain 342) GN=bioF PE=3 SV=1 | 168 | 381 | 1.0E-09 |
| sp|B1LYP9|BIOF_METRJ | 8-amino-7-oxononanoate synthase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=Mrad2831_0866 PE=3 SV=1 | 174 | 364 | 3.0E-09 |
| sp|B4RFX5|BIOF_PHEZH | Putative 8-amino-7-oxononanoate synthase OS=Phenylobacterium zucineum (strain HLK1) GN=bioF PE=3 SV=1 | 121 | 364 | 5.0E-09 |
| sp|P18080|HEM0_CHICK | 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Gallus gallus GN=ALAS2 PE=2 SV=2 | 153 | 364 | 1.0E-08 |
| sp|A7N6R9|CQSA_VIBCB | CAI-1 autoinducer synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cqsA PE=1 SV=2 | 163 | 410 | 1.0E-08 |
| sp|Q12D74|BIOF2_POLSJ | 8-amino-7-oxononanoate synthase 2 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=bioF2 PE=3 SV=1 | 112 | 380 | 2.0E-08 |
| sp|Q6CCW0|HEM1_YARLI | 5-aminolevulinate synthase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HEM1 PE=3 SV=1 | 125 | 432 | 6.0E-08 |
| sp|B2HQ90|BIOF_MYCMM | 8-amino-7-oxononanoate synthase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=MMAR_2384 PE=3 SV=1 | 124 | 297 | 8.0E-08 |
| sp|B0UKC8|BIOF_METS4 | 8-amino-7-oxononanoate synthase OS=Methylobacterium sp. (strain 4-46) GN=M446_5168 PE=3 SV=1 | 121 | 360 | 8.0E-08 |
| sp|A0PP02|BIOF_MYCUA | 8-amino-7-oxononanoate synthase OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_1560 PE=3 SV=1 | 124 | 297 | 8.0E-08 |
| sp|Q1LS75|BIOF_CUPMC | 8-amino-7-oxononanoate synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=bioF PE=3 SV=1 | 130 | 399 | 9.0E-08 |
| sp|Q87DT2|BIOF_XYLFT | 8-amino-7-oxononanoate synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=bioF PE=3 SV=1 | 154 | 360 | 1.0E-07 |
| sp|B2I9H7|BIOF_XYLF2 | 8-amino-7-oxononanoate synthase OS=Xylella fastidiosa (strain M23) GN=bioF PE=3 SV=1 | 154 | 360 | 1.0E-07 |
| sp|B0U6J0|BIOF_XYLFM | 8-amino-7-oxononanoate synthase OS=Xylella fastidiosa (strain M12) GN=bioF PE=3 SV=1 | 154 | 360 | 1.0E-07 |
| sp|Q8XZC3|BIOF_RALSO | 8-amino-7-oxononanoate synthase OS=Ralstonia solanacearum (strain GMI1000) GN=bioF PE=3 SV=1 | 123 | 311 | 1.0E-07 |
| sp|A4JIB5|BIOF_BURVG | 8-amino-7-oxononanoate synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=bioF PE=3 SV=1 | 121 | 305 | 3.0E-07 |
| sp|Q9PDM2|BIOF_XYLFA | 8-amino-7-oxononanoate synthase OS=Xylella fastidiosa (strain 9a5c) GN=bioF PE=3 SV=1 | 154 | 360 | 5.0E-07 |
| sp|A8GBC6|BIOF_SERP5 | 8-amino-7-oxononanoate synthase OS=Serratia proteamaculans (strain 568) GN=bioF PE=3 SV=1 | 111 | 396 | 6.0E-07 |
| sp|P45487|BIOF_MYCLE | 8-amino-7-oxononanoate synthase OS=Mycobacterium leprae (strain TN) GN=ML1217 PE=3 SV=1 | 124 | 297 | 1.0E-06 |
| sp|B8ZR84|BIOF_MYCLB | 8-amino-7-oxononanoate synthase OS=Mycobacterium leprae (strain Br4923) GN=MLBr01217 PE=3 SV=1 | 124 | 297 | 1.0E-06 |
| sp|B4E9L6|BIOF_BURCJ | 8-amino-7-oxononanoate synthase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=bioF PE=3 SV=1 | 121 | 358 | 1.0E-06 |
| sp|A0KB03|BIOF_BURCH | 8-amino-7-oxononanoate synthase OS=Burkholderia cenocepacia (strain HI2424) GN=bioF PE=3 SV=1 | 121 | 358 | 2.0E-06 |
| sp|Q1BT36|BIOF_BURCA | 8-amino-7-oxononanoate synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=bioF PE=3 SV=1 | 121 | 358 | 2.0E-06 |
| sp|B1JZD9|BIOF_BURCC | 8-amino-7-oxononanoate synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=bioF PE=3 SV=1 | 121 | 358 | 3.0E-06 |
| sp|Q8PDF1|BIOF_XANCP | 8-amino-7-oxononanoate synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=bioF PE=3 SV=1 | 165 | 364 | 3.0E-06 |
| sp|Q4UZN9|BIOF_XANC8 | 8-amino-7-oxononanoate synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=bioF PE=3 SV=1 | 165 | 364 | 3.0E-06 |
| sp|B0RMR1|BIOF_XANCB | 8-amino-7-oxononanoate synthase OS=Xanthomonas campestris pv. campestris (strain B100) GN=bioF PE=3 SV=1 | 165 | 364 | 3.0E-06 |
| sp|Q3BYN0|BIOF_XANC5 | 8-amino-7-oxononanoate synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=bioF PE=3 SV=2 | 165 | 364 | 3.0E-06 |
| sp|Q8PQD8|BIOF_XANAC | 8-amino-7-oxononanoate synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=bioF PE=3 SV=1 | 165 | 364 | 5.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0009058 | biosynthetic process | Yes |
| GO:0030170 | pyridoxal phosphate binding | Yes |
| GO:0070279 | vitamin B6 binding | No |
| GO:0003674 | molecular_function | No |
| GO:0043167 | ion binding | No |
| GO:0005488 | binding | No |
| GO:0036094 | small molecule binding | No |
| GO:0008152 | metabolic process | No |
| GO:0043168 | anion binding | No |
| GO:0008150 | biological_process | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0019842 | vitamin binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 20 | 0.5 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >OphauB2|4582 MELDALRMRVGEGLQQVRATFEKMPGSAVLVRYIQSSYQNDPVRSAIELVLVLFFIRYLLSPSYPAHEPNYVKLG EDEIDELIDDWTPEPLVANRTPIEESESEKLPVIVGPTGPKVKLSNGRTVTNLASYNFYNFNCNEQLKEKAIQTL RTYGVGPCGPPQFYGTQDVHVKAEADIASYLGTEGCIVYAQAFSAVSSVIPAFCKRGDVIIADMAVNYAIRKGLQ ASRSNIKWFGHGDMDHLERVMAAVAREQAQSKRLTRRFVVTEGLFETTGDATDLPRLVELKERYKFRIILDETWS FGVVGRTGRGLTEAQNVDPQQVDMIIGSLSGPLCAGGGFCAGAKDVVEHQRITSSAYTYSAALPAMLAMTASETV HMLQSNPDILTQCRENIRIMRAQLDPRSDWVRCTSVADNPVLLLVLKPDVVRARKLSIEDEERILMDCADESLAN GVMIARFKTRPYAHAMAAKAKGEQESGWRVQPALKVCITSALSKKDIEKAGVTIRHAITKVMSRKTSTNKL* |
| Coding | >OphauB2|4582 ATGGAACTCGACGCGCTTCGGATGCGAGTAGGTGAGGGATTGCAGCAAGTACGGGCTACTTTTGAAAAGATGCCT GGTTCCGCCGTGCTGGTGCGATATATCCAGTCGAGCTACCAAAATGATCCGGTGCGATCGGCAATTGAACTTGTG CTCGTCTTGTTCTTTATTCGCTACCTGTTGTCTCCCTCGTATCCGGCACATGAGCCTAATTATGTCAAACTGGGC GAAGATGAAATTGACGAGTTGATTGATGACTGGACACCAGAACCGCTTGTCGCGAACAGGACACCGATTGAAGAG TCGGAGAGTGAAAAGCTTCCTGTTATTGTTGGTCCAACGGGCCCCAAGGTTAAATTATCCAACGGACGGACGGTA ACGAATTTAGCGTCGTATAACTTTTATAACTTCAACTGCAACGAGCAGCTCAAGGAGAAGGCTATACAAACACTG AGAACGTATGGCGTTGGCCCGTGTGGTCCCCCGCAGTTTTACGGTACCCAAGACGTTCACGTAAAGGCTGAAGCC GACATTGCCTCGTATTTGGGCACCGAGGGGTGCATAGTCTACGCACAAGCCTTCTCGGCCGTGTCAAGTGTCATA CCGGCTTTTTGCAAGCGAGGTGATGTGATAATCGCAGATATGGCAGTCAATTATGCTATTCGAAAGGGTCTACAG GCGTCGAGGAGCAACATTAAATGGTTCGGGCATGGTGATATGGACCACCTGGAGCGTGTCATGGCGGCTGTGGCG AGAGAACAGGCGCAGAGTAAGCGACTGACGCGGCGATTTGTCGTGACAGAGGGTCTATTCGAGACGACGGGTGAC GCGACAGACCTGCCAAGACTAGTCGAACTCAAGGAACGATACAAATTCCGCATAATACTCGATGAAACGTGGTCG TTTGGTGTCGTAGGACGGACAGGCCGAGGTCTTACAGAAGCGCAAAACGTGGACCCACAGCAGGTTGACATGATT ATCGGCTCGCTGTCGGGGCCCCTGTGCGCCGGCGGAGGCTTTTGCGCAGGAGCAAAGGACGTTGTGGAACACCAA CGCATCACATCTTCGGCATATACATACTCGGCTGCGCTCCCAGCCATGTTGGCCATGACAGCTAGCGAGACGGTG CACATGCTACAGTCCAACCCGGATATTCTGACGCAATGTCGGGAGAATATACGCATCATGAGAGCGCAACTGGAC CCGCGCAGCGACTGGGTTCGGTGTACTAGTGTGGCTGACAATCCCGTGTTGCTTCTCGTGCTTAAGCCTGACGTG GTGAGGGCGAGAAAACTTAGTATTGAGGACGAGGAGCGCATCTTGATGGATTGCGCCGACGAGTCACTTGCCAAT GGCGTGATGATAGCGCGCTTCAAAACGAGGCCATATGCGCATGCCATGGCGGCCAAGGCAAAGGGCGAGCAAGAG AGTGGCTGGCGGGTGCAACCGGCGCTCAAGGTATGCATCACTTCGGCCTTGTCTAAAAAGGACATTGAAAAGGCG GGGGTGACGATTCGGCACGCCATTACAAAGGTCATGTCGCGCAAGACGAGCACCAACAAATTGTAA |
| Transcript | >OphauB2|4582 ATGGAACTCGACGCGCTTCGGATGCGAGTAGGTGAGGGATTGCAGCAAGTACGGGCTACTTTTGAAAAGATGCCT GGTTCCGCCGTGCTGGTGCGATATATCCAGTCGAGCTACCAAAATGATCCGGTGCGATCGGCAATTGAACTTGTG CTCGTCTTGTTCTTTATTCGCTACCTGTTGTCTCCCTCGTATCCGGCACATGAGCCTAATTATGTCAAACTGGGC GAAGATGAAATTGACGAGTTGATTGATGACTGGACACCAGAACCGCTTGTCGCGAACAGGACACCGATTGAAGAG TCGGAGAGTGAAAAGCTTCCTGTTATTGTTGGTCCAACGGGCCCCAAGGTTAAATTATCCAACGGACGGACGGTA ACGAATTTAGCGTCGTATAACTTTTATAACTTCAACTGCAACGAGCAGCTCAAGGAGAAGGCTATACAAACACTG AGAACGTATGGCGTTGGCCCGTGTGGTCCCCCGCAGTTTTACGGTACCCAAGACGTTCACGTAAAGGCTGAAGCC GACATTGCCTCGTATTTGGGCACCGAGGGGTGCATAGTCTACGCACAAGCCTTCTCGGCCGTGTCAAGTGTCATA CCGGCTTTTTGCAAGCGAGGTGATGTGATAATCGCAGATATGGCAGTCAATTATGCTATTCGAAAGGGTCTACAG GCGTCGAGGAGCAACATTAAATGGTTCGGGCATGGTGATATGGACCACCTGGAGCGTGTCATGGCGGCTGTGGCG AGAGAACAGGCGCAGAGTAAGCGACTGACGCGGCGATTTGTCGTGACAGAGGGTCTATTCGAGACGACGGGTGAC GCGACAGACCTGCCAAGACTAGTCGAACTCAAGGAACGATACAAATTCCGCATAATACTCGATGAAACGTGGTCG TTTGGTGTCGTAGGACGGACAGGCCGAGGTCTTACAGAAGCGCAAAACGTGGACCCACAGCAGGTTGACATGATT ATCGGCTCGCTGTCGGGGCCCCTGTGCGCCGGCGGAGGCTTTTGCGCAGGAGCAAAGGACGTTGTGGAACACCAA CGCATCACATCTTCGGCATATACATACTCGGCTGCGCTCCCAGCCATGTTGGCCATGACAGCTAGCGAGACGGTG CACATGCTACAGTCCAACCCGGATATTCTGACGCAATGTCGGGAGAATATACGCATCATGAGAGCGCAACTGGAC CCGCGCAGCGACTGGGTTCGGTGTACTAGTGTGGCTGACAATCCCGTGTTGCTTCTCGTGCTTAAGCCTGACGTG GTGAGGGCGAGAAAACTTAGTATTGAGGACGAGGAGCGCATCTTGATGGATTGCGCCGACGAGTCACTTGCCAAT GGCGTGATGATAGCGCGCTTCAAAACGAGGCCATATGCGCATGCCATGGCGGCCAAGGCAAAGGGCGAGCAAGAG AGTGGCTGGCGGGTGCAACCGGCGCTCAAGGTATGCATCACTTCGGCCTTGTCTAAAAAGGACATTGAAAAGGCG GGGGTGACGATTCGGCACGCCATTACAAAGGTCATGTCGCGCAAGACGAGCACCAACAAATTGTAA |
| Gene | >OphauB2|4582 ATGGAACTCGACGCGCTTCGGATGCGAGTAGGTGAGGGATTGCAGCAAGTACGGGCTACTTTTGAAAAGATGCCT GGTTCCGCCGTGCTGGTGCGATATATCCAGTCGAGCTACCAAAATGATCCGGTGCGATCGGCAATTGAACTTGTG CTCGTCTTGTTCTTTATTCGCTACCTGTTGTCTCCCTCGTATCCGGCACATGAGCCTAATTATGTCAAACTGGGC GAAGATGTAAGAGGGCAAGATGCTGTTGGCATGTGATTGGATTGATGACTGAGAAACGCATAATTCAACCATAGG AAATTGACGAGTTGATTGATGACTGGACACCAGAACCGCTTGTCGCGAACAGGACACCGATTGAAGAGTCGGAGA GTGAAAAGCTTCCTGTTATTGTTGGGTAAGCTAGCAGTATCAGTCTGGATACAAGAGAAAGTGGCATATTGCATG GGAGAGGCTGACTTTGTTGACGCAATCGTGCCTCAGTCCAACGGGCCCCAAGGTTAAATTATCCAACGGACGGAC GGTAACGAATTTAGCGTCGTATAACTTTTATAACTTCAACTGCAACGAGCAGCTCAAGGAGAAGGCTATACAAAC ACTGAGAACGTATGGCGTTGGCCCGTGTGGTCCCCCGCAGTTTTACGGTACCCAAGACGTTCACGTAAAGGCTGA AGCCGACATTGCCTCGTATTTGGGCACCGAGGGGTGCATAGTCTACGCACAAGCCTTCTCGGCCGTGTCAAGTGT CATACCGGCTTTTTGCAAGCGAGGTGATGTGATAATCGCAGATATGGCAGTCAATTATGCTATTCGAAAGGGTCT ACAGGCGTCGAGGAGCAACATTAAATGGTTCGGGCATGGTGATATGGACCACCTGGAGCGTGTCATGGCGGCTGT GGCGAGAGAACAGGCGCAGAGTAAGCGACTGACGCGGCGATTTGTCGTGACAGAGGGTCTATTCGAGACGACGGG TGACGCGACAGACCTGCCAAGACTAGTCGAACTCAAGGAACGATACAAATTCCGCATAATACTCGATGAAACGTG GTCGTTTGGTGTCGTAGGACGGACAGGCCGAGGTCTTACAGAAGCGCAAAACGTGGACCCACAGCAGGTTGACAT GATTATCGGCTCGCTGTCGGGGCCCCTGTGCGCCGGCGGAGGCTTTTGCGCAGGAGCAAAGGACGTTGTGGAACA CCAACGCATCACATCTTCGGCATATACATACTCGGCTGCGCTCCCAGCCATGTTGGCCATGACAGCTAGCGAGAC GGTGCACATGCTACAGTCCAACCCGGATATTCTGACGCAATGTCGGGAGAATATACGCATCATGAGAGCGCAACT GGACCCGCGCAGCGACTGGGTTCGGTGTACTAGTGTGGCTGACAATCCCGTGTTGCTTCTCGTGCTTAAGCCTGA CGTGGTGAGGGCGAGAAAACTTAGTATTGAGGACGAGGAGCGCATCTTGATGGATTGCGCCGACGAGGTTGGTAG TGCTCCTTTGTATTGTTTTGTTTTGGCTGGACGAGGAAAAGGCTGATTACTGACGAGGCTAATGGACAGTCACTT GCCAATGGCGTGATGATAGCGCGCTTCAAAACGAGGCCATATGCGCATGCCATGGCGGCCAAGGCAAAGGGCGAG CAAGAGAGTGGCTGGCGGGTGCAACCGGCGCTCAAGGTATGCATCACTTCGGCCTTGTCTAAAAAGGACATTGAA AAGGCGGGGGTGACGATTCGGCACGCCATTACAAAGGTCATGTCGCGCAAGACGAGCACCAACAAATTGTAA |