Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4579
Gene name
LocationContig_300:516..2082
Strand+
Gene length (bp)1566
Transcript length (bp)1050
Coding sequence length (bp)1050
Protein length (aa) 350

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1915
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|660
Ophiocordyceps australis map64 (Brazil) OphauB2|4579 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03882
Ophiocordyceps camponoti-rufipedis Ophun1|144
Ophiocordyceps kimflemingae Ophio5|1625
Ophiocordyceps subramaniannii Hirsu2|201

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4579
MSYYDNPQWPAPGQNNWEHQGTVTPIRAAGASGPQPQDDFAFSYQFDEIDRAYENLQKSGKGFPISGRHMRVSHG
GGPRSHSVSNFDDVRSNQGSNLHNFYAAQRHQPSRGNNEAEQVMQAKRRMAAQRERELRNLHTEQQYQRNVLAEV
SQHGNKHMSEEETRELIARQRSALYGEGPFADKSSYIDETGNIRPGAPAASGPSSLRGPSPMTFESIGRSPSGAD
AGTPSSLNDPNVVSNDPSPRSQSTTSPQATGPTNRVFDNALGSQCRTSNSSPTGASPPRDHGPGSKSIQSATTVA
PIGTRPAHNSTSSNAKRSTTPMAPSGGWGRGNGVWGQTSGLGAQASVWG*
Coding >OphauB2|4579
ATGTCCTACTACGACAATCCTCAGTGGCCCGCCCCCGGCCAAAACAACTGGGAGCACCAGGGCACTGTCACTCCC
ATACGCGCTGCCGGAGCTAGCGGACCTCAGCCGCAAGACGACTTTGCATTTTCATACCAGTTCGATGAAATTGAT
CGAGCGTACGAAAACCTGCAAAAGTCTGGCAAGGGCTTTCCAATCAGCGGACGCCATATGCGAGTGTCCCATGGC
GGTGGTCCTCGTTCACACTCTGTCAGCAACTTTGATGACGTCCGAAGCAACCAGGGGTCCAACCTACACAACTTC
TATGCCGCTCAACGCCACCAGCCTTCACGCGGTAACAACGAGGCAGAGCAGGTCATGCAGGCAAAGAGAAGGATG
GCTGCTCAGCGGGAACGAGAGCTGCGCAACCTTCACACGGAGCAGCAATACCAACGAAATGTCTTGGCTGAAGTG
TCGCAGCATGGCAACAAGCACATGTCTGAAGAAGAGACGCGCGAGCTCATTGCTCGTCAGCGAAGCGCCCTATAC
GGCGAGGGTCCTTTTGCCGACAAGAGTAGCTATATCGATGAGACGGGCAATATTCGGCCTGGCGCTCCCGCCGCA
AGCGGCCCATCGAGCCTGCGTGGTCCCTCGCCCATGACATTTGAGAGCATTGGCCGCTCTCCCTCTGGAGCCGAC
GCTGGCACTCCCAGCTCCCTCAACGACCCCAATGTCGTGTCCAACGATCCTAGCCCAAGGTCCCAGAGCACCACG
AGTCCCCAGGCGACGGGTCCAACAAATAGGGTTTTTGACAACGCCCTTGGCTCGCAGTGCCGTACCAGCAATTCG
AGTCCCACTGGAGCATCCCCTCCTCGCGATCATGGGCCTGGATCCAAGTCGATTCAGTCGGCCACAACGGTGGCA
CCCATTGGTACCCGCCCAGCTCACAACTCGACGTCGTCCAACGCAAAGAGATCTACCACACCCATGGCACCCTCT
GGTGGATGGGGCCGCGGCAACGGCGTCTGGGGCCAGACGTCTGGCCTTGGTGCTCAGGCAAGTGTCTGGGGCTAG
Transcript >OphauB2|4579
ATGTCCTACTACGACAATCCTCAGTGGCCCGCCCCCGGCCAAAACAACTGGGAGCACCAGGGCACTGTCACTCCC
ATACGCGCTGCCGGAGCTAGCGGACCTCAGCCGCAAGACGACTTTGCATTTTCATACCAGTTCGATGAAATTGAT
CGAGCGTACGAAAACCTGCAAAAGTCTGGCAAGGGCTTTCCAATCAGCGGACGCCATATGCGAGTGTCCCATGGC
GGTGGTCCTCGTTCACACTCTGTCAGCAACTTTGATGACGTCCGAAGCAACCAGGGGTCCAACCTACACAACTTC
TATGCCGCTCAACGCCACCAGCCTTCACGCGGTAACAACGAGGCAGAGCAGGTCATGCAGGCAAAGAGAAGGATG
GCTGCTCAGCGGGAACGAGAGCTGCGCAACCTTCACACGGAGCAGCAATACCAACGAAATGTCTTGGCTGAAGTG
TCGCAGCATGGCAACAAGCACATGTCTGAAGAAGAGACGCGCGAGCTCATTGCTCGTCAGCGAAGCGCCCTATAC
GGCGAGGGTCCTTTTGCCGACAAGAGTAGCTATATCGATGAGACGGGCAATATTCGGCCTGGCGCTCCCGCCGCA
AGCGGCCCATCGAGCCTGCGTGGTCCCTCGCCCATGACATTTGAGAGCATTGGCCGCTCTCCCTCTGGAGCCGAC
GCTGGCACTCCCAGCTCCCTCAACGACCCCAATGTCGTGTCCAACGATCCTAGCCCAAGGTCCCAGAGCACCACG
AGTCCCCAGGCGACGGGTCCAACAAATAGGGTTTTTGACAACGCCCTTGGCTCGCAGTGCCGTACCAGCAATTCG
AGTCCCACTGGAGCATCCCCTCCTCGCGATCATGGGCCTGGATCCAAGTCGATTCAGTCGGCCACAACGGTGGCA
CCCATTGGTACCCGCCCAGCTCACAACTCGACGTCGTCCAACGCAAAGAGATCTACCACACCCATGGCACCCTCT
GGTGGATGGGGCCGCGGCAACGGCGTCTGGGGCCAGACGTCTGGCCTTGGTGCTCAGGCAAGTGTCTGGGGCTAG
Gene >OphauB2|4579
ATGTCCTACTACGACAATCCTCAGTGGCCCGCCCCCGGCCAAAACAACTGGGAGCACCAGGGCACTGTCACTCCC
ATACGCGCTGGTACATATTGGCCCACACTTTGTTCCGTCATGCTTGGCTTTTAAGTGGCGGCTTGACTGACTTTG
ATGCGTGTAGCCGGAGCTAGCGGACCTCAGCCGCAAGACGACTTTGCATTTTCATACCAGTTCGATGGTATGTCA
CAATTCCCATTATTGATACCAAGCCATGGTCATCATGATTATACCTCGGCTTGAAGCCGTCGACGCCGAGATTAT
GCATGACAGACGGTGCCACACAGCAGCTGACGTGTGTTGCAGAAATTGATCGAGCGTACGAAAACCTGCAAAAGT
CTGGCAAGGGCTTTCCAATCAGCGGACGCCGTAAGTCTTGTCACTCTTGCGGCATGACGACACTACACTGGCACC
TGGCCCAATGATTACTCAAATAATGGCAGTCGTATGCTTTTCATGGCATTTAGCTGACGCTGTGCTTGATGGAGT
AGATATGCGAGTGTCCCATGGCGGTGGTCCTCGTTCACACTCTGTCAGCAACTTTGATGACGTCCGAAGCAACCA
GGGGTCCAACCTACACAACTTCTATGCCGCTCAACGCCACCAGCCTTCACGCGGTAACAACGAGGCAGAGCAGGT
CATGCAGGCAAAGAGAAGGATGGCTGCTCAGCGGGAACGAGAGCTGCGCAACCTTCACACGGAGCAGCAATACCA
ACGAAGTAGGCCGCCCTCTGCAGTATAGCACTCTTTTCAAAGGATACCCCCGAAAATAGAAGTTCCTGACACCTG
GTGGCTGGCCCATGTCCCCCCTCTCACATGCTCATGGCCCTGTTTCCCTTTGACGGCACCATGATGCTCTCGATG
GACATTTATGAGCACATTTATGAGCAAGGGCTAACGATGCGCAACGTAGATGTCTTGGCTGAAGTGTCGCAGCAT
GGCAACAAGCACATGTCTGAAGAAGAGACGCGCGAGCTCATTGCTCGTCAGCGAAGCGCCCTATACGGCGAGGGT
CCTTTTGCCGACAAGAGTAGCTATATCGATGAGACGGGCAATATTCGGCCTGGCGCTCCCGCCGCAAGCGGCCCA
TCGAGCCTGCGTGGTCCCTCGCCCATGACATTTGAGAGCATTGGCCGCTCTCCCTCTGGAGCCGACGCTGGCACT
CCCAGCTCCCTCAACGACCCCAATGTCGTGTCCAACGATCCTAGCCCAAGGTCCCAGAGCACCACGAGTCCCCAG
GCGACGGGTCCAACAAATAGGGTTTTTGACAACGCCCTTGGCTCGCAGTGCCGTACCAGCAATTCGAGTCCCACT
GGAGCATCCCCTCCTCGCGATCATGGGCCTGGATCCAAGTCGATTCAGTCGGCCACAACGGTGGCACCCATTGGT
ACCCGCCCAGCTCACAACTCGACGTCGTCCAACGCAAAGAGATCTACCACACCCATGGCACCCTCTGGTGGATGG
GGCCGCGGCAACGGCGTCTGGGGCCAGACGTCTGGCCTTGGTGCTCAGGCAAGTGTCTGGGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail