Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4574
Gene name
LocationContig_30:146440..146827
Strand-
Gene length (bp)387
Transcript length (bp)387
Coding sequence length (bp)387
Protein length (aa) 129

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 1.3E-17 10 102

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9US38|YFZ3_SCHPO AB hydrolase superfamily protein C1039.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.03 PE=3 SV=1 1 112 1.0E-21

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3034
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7051
Ophiocordyceps australis map64 (Brazil) OphauB2|4574 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01658
Ophiocordyceps camponoti-rufipedis Ophun1|1301
Ophiocordyceps kimflemingae Ophio5|3691
Ophiocordyceps subramaniannii Hirsu2|5241

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4574
MDNTASIDTNPSWSANQHAPGLPADKMLWFRSLYLPDEQQRHLAEASPLLWEGNWASLPPAVVLLGELDVLLYEG
QMFAQKLADAGVEVDVHTFKGQPHTFLAMDRVLDDGRRAITLFCEAMAKLTSS*
Coding >OphauB2|4574
ATGGACAACACGGCCAGCATCGACACAAACCCATCGTGGTCCGCCAACCAGCATGCCCCGGGCCTGCCTGCTGAC
AAGATGCTCTGGTTCCGCAGCTTATACTTGCCTGACGAGCAGCAGCGCCACCTGGCAGAGGCTAGTCCGCTGTTG
TGGGAGGGCAATTGGGCCTCTCTTCCGCCAGCCGTGGTGCTCCTCGGCGAGCTCGACGTGCTCCTTTACGAGGGC
CAAATGTTTGCGCAGAAGCTGGCGGATGCAGGAGTCGAGGTAGACGTGCACACTTTCAAGGGCCAACCGCATACC
TTCCTGGCCATGGACAGGGTTCTTGACGACGGGCGGCGAGCAATCACCTTGTTTTGCGAGGCCATGGCCAAATTG
ACATCGAGTTGA
Transcript >OphauB2|4574
ATGGACAACACGGCCAGCATCGACACAAACCCATCGTGGTCCGCCAACCAGCATGCCCCGGGCCTGCCTGCTGAC
AAGATGCTCTGGTTCCGCAGCTTATACTTGCCTGACGAGCAGCAGCGCCACCTGGCAGAGGCTAGTCCGCTGTTG
TGGGAGGGCAATTGGGCCTCTCTTCCGCCAGCCGTGGTGCTCCTCGGCGAGCTCGACGTGCTCCTTTACGAGGGC
CAAATGTTTGCGCAGAAGCTGGCGGATGCAGGAGTCGAGGTAGACGTGCACACTTTCAAGGGCCAACCGCATACC
TTCCTGGCCATGGACAGGGTTCTTGACGACGGGCGGCGAGCAATCACCTTGTTTTGCGAGGCCATGGCCAAATTG
ACATCGAGTTGA
Gene >OphauB2|4574
ATGGACAACACGGCCAGCATCGACACAAACCCATCGTGGTCCGCCAACCAGCATGCCCCGGGCCTGCCTGCTGAC
AAGATGCTCTGGTTCCGCAGCTTATACTTGCCTGACGAGCAGCAGCGCCACCTGGCAGAGGCTAGTCCGCTGTTG
TGGGAGGGCAATTGGGCCTCTCTTCCGCCAGCCGTGGTGCTCCTCGGCGAGCTCGACGTGCTCCTTTACGAGGGC
CAAATGTTTGCGCAGAAGCTGGCGGATGCAGGAGTCGAGGTAGACGTGCACACTTTCAAGGGCCAACCGCATACC
TTCCTGGCCATGGACAGGGTTCTTGACGACGGGCGGCGAGCAATCACCTTGTTTTGCGAGGCCATGGCCAAATTG
ACATCGAGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail