Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4572
Gene name
LocationContig_30:140894..143122
Strand+
Gene length (bp)2228
Transcript length (bp)2109
Coding sequence length (bp)2109
Protein length (aa) 703

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03828 PAP_assoc Cid1 family poly A polymerase 5.8E-12 573 630
PF01909 NTP_transf_2 Nucleotidyltransferase domain 2.5E-08 399 499

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53632|PAP2_YEAST Poly(A) RNA polymerase protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAP2 PE=1 SV=1 353 660 3.0E-53
sp|Q9HFW3|TRF5_ASHGO Poly(A) RNA polymerase protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TRF5 PE=3 SV=1 353 660 2.0E-51
sp|P48561|TRF5_YEAST Poly(A) RNA polymerase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRF5 PE=1 SV=2 353 686 3.0E-50
sp|Q9UTN3|CID14_SCHPO Poly(A) RNA polymerase cid14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid14 PE=1 SV=2 193 669 6.0E-48
sp|Q68ED3|PAPD5_MOUSE Non-canonical poly(A) RNA polymerase PAPD5 OS=Mus musculus GN=Papd5 PE=1 SV=2 366 662 3.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53632|PAP2_YEAST Poly(A) RNA polymerase protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAP2 PE=1 SV=1 353 660 3.0E-53
sp|Q9HFW3|TRF5_ASHGO Poly(A) RNA polymerase protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TRF5 PE=3 SV=1 353 660 2.0E-51
sp|P48561|TRF5_YEAST Poly(A) RNA polymerase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRF5 PE=1 SV=2 353 686 3.0E-50
sp|Q9UTN3|CID14_SCHPO Poly(A) RNA polymerase cid14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid14 PE=1 SV=2 193 669 6.0E-48
sp|Q68ED3|PAPD5_MOUSE Non-canonical poly(A) RNA polymerase PAPD5 OS=Mus musculus GN=Papd5 PE=1 SV=2 366 662 3.0E-47
sp|Q8NDF8|PAPD5_HUMAN Non-canonical poly(A) RNA polymerase PAPD5 OS=Homo sapiens GN=PAPD5 PE=1 SV=2 366 662 4.0E-47
sp|Q5XG87|PAPD7_HUMAN Non-canonical poly(A) RNA polymerase PAPD7 OS=Homo sapiens GN=PAPD7 PE=1 SV=3 369 662 4.0E-43
sp|Q6PB75|PAPD7_MOUSE Non-canonical poly(A) RNA polymerase PAPD7 OS=Mus musculus GN=Papd7 PE=2 SV=2 386 662 5.0E-37
sp|G5EFL0|GLD4_CAEEL Poly(A) RNA polymerase gld-4 OS=Caenorhabditis elegans GN=gld-4 PE=1 SV=1 320 674 5.0E-35
sp|Q5VYS8|TUT7_HUMAN Terminal uridylyltransferase 7 OS=Homo sapiens GN=ZCCHC6 PE=1 SV=1 369 646 3.0E-12
sp|Q5BLK4|TUT7_MOUSE Terminal uridylyltransferase 7 OS=Mus musculus GN=Zcchc6 PE=1 SV=3 369 646 2.0E-11
sp|Q6DFA8|GLD2B_XENLA Poly(A) RNA polymerase GLD2-B OS=Xenopus laevis GN=papd4-b PE=1 SV=1 368 599 3.0E-11
sp|Q641A1|GLD2A_XENLA Poly(A) RNA polymerase GLD2-A OS=Xenopus laevis GN=papd4-a PE=1 SV=1 368 630 6.0E-11
sp|O64642|URT1_ARATH UTP:RNA uridylyltransferase 1 OS=Arabidopsis thaliana GN=URT1 PE=1 SV=2 368 563 6.0E-11
sp|O74326|CID11_SCHPO Poly(A) RNA polymerase cid11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid11 PE=3 SV=1 369 680 2.0E-10
sp|Q503I9|GLD2_DANRE Poly(A) RNA polymerase GLD2 OS=Danio rerio GN=papd4 PE=2 SV=1 368 598 5.0E-10
sp|Q0VFA3|GLD2_XENTR Poly(A) RNA polymerase GLD2 OS=Xenopus tropicalis GN=papd4 PE=2 SV=1 368 599 5.0E-09
sp|O74518|CID12_SCHPO Poly(A) RNA polymerase cid12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid12 PE=1 SV=1 376 646 9.0E-09
sp|Q9UT49|CID13_SCHPO Poly(A) RNA polymerase cid13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid13 PE=1 SV=1 390 598 3.0E-08
sp|Q5XET5|HESO1_ARATH Protein HESO1 OS=Arabidopsis thaliana GN=HESO1 PE=1 SV=1 375 558 1.0E-07
sp|Q2HJ44|GLD2_BOVIN Poly(A) RNA polymerase GLD2 OS=Bos taurus GN=PAPD4 PE=2 SV=1 368 599 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016779 nucleotidyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3504
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1281
Ophiocordyceps australis map64 (Brazil) OphauB2|4572 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01660
Ophiocordyceps camponoti-rufipedis Ophun1|201
Ophiocordyceps kimflemingae Ophio5|3694
Ophiocordyceps subramaniannii Hirsu2|6706

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4572
MSRRNEPPSRRGDDLYDSWRPLSNHHSHDSYRAGADSHRPSQPHRAYESYRPSGHSAPESRGRFSQQAYQQPQPP
QSDFTFRLDYPHTSFTPINPRADRPGQGPRRSDRDRSRRLPIAHKRPRWKPPHPSERALISGDTYVQPSERLHEN
GAKFRNPDDLSDDDEVDMIISSSESASDKPPKKRVRIDANVDNDDAPKWSNPDPYTALPCPDETRRRKPDVVQLI
RKARVEETKPVVETVPEAENFLSFDLSASEGEANESLPTTKSSLPGSHSRPPNLPPRPPVSEVLPTPVTKVNRPL
APDRSGPLGSRKRTADDVIKPPDYGRLNKAKMKPSKGTLVAQWEPKAGQDLCPWVLTDHASEANMAVRLHKEIVD
FYEFVRPKKFEQRIRENLVQNLQKAMRRDPRFSSAKIHAFGSYMSGLYLPTADMDLVVCSASYMSGGPPTFLGAR
SWLHKFAQFLVVQKMSEKENVEVIARARVPLVKFVDTLTGLRVDVSFENLGGVQAIDTFLQWKADYPAMPALVTV
VKHFLLMRGLNEPVNGGIGGFSVICLVVSMLQVLPHIQSRSAPSAHHLGELLLIFFELYGRHFRYDKVAISLRDP
IGYVRKSEVLSLTYRNTDRLSIIDPNNASNDITGGASNTGAILSCFHDAFVALTERMREVAQQPGNGGILDVLLE
GDYSSFRMQRRYLKHVYEGVFGPCRDE*
Coding >OphauB2|4572
ATGTCTAGACGCAACGAACCGCCCTCGCGGCGTGGCGACGATCTTTACGATAGCTGGCGCCCGCTCAGCAATCAC
CATAGCCACGATTCTTATCGAGCAGGAGCAGACTCGCATCGGCCGTCGCAACCACATCGAGCATACGAGTCGTAT
CGCCCATCGGGTCACTCTGCCCCCGAGTCTCGCGGCCGCTTCTCCCAGCAGGCCTACCAACAGCCCCAACCTCCA
CAGTCAGATTTCACCTTTCGCCTCGATTATCCTCACACAAGCTTCACTCCCATCAATCCGAGAGCAGATAGGCCC
GGCCAAGGGCCGCGCAGGTCTGATCGTGACCGGTCTAGGCGCTTGCCCATAGCGCATAAGCGTCCTCGCTGGAAA
CCTCCCCATCCCTCTGAGCGTGCCTTGATCTCTGGCGACACGTACGTACAGCCCAGCGAGCGTCTCCACGAGAAC
GGTGCCAAGTTTCGCAACCCCGACGACCTGTCTGACGACGACGAGGTTGATATGATCATATCGTCGTCTGAATCT
GCATCTGACAAGCCCCCCAAGAAGCGGGTGCGAATAGACGCCAACGTGGATAATGACGATGCTCCTAAGTGGTCC
AATCCTGATCCATATACGGCGCTTCCATGCCCCGACGAGACACGACGCAGGAAGCCTGATGTGGTACAGCTGATT
CGCAAGGCTCGTGTTGAAGAAACTAAGCCAGTTGTTGAGACTGTCCCCGAGGCTGAAAATTTTTTGTCGTTTGAT
CTTTCGGCTAGTGAGGGTGAGGCCAACGAGTCGCTACCCACCACCAAGAGCTCTCTCCCAGGCTCGCATTCACGG
CCACCCAATCTTCCGCCCCGCCCCCCAGTCTCAGAGGTGCTCCCCACTCCTGTGACCAAGGTCAACAGGCCATTG
GCCCCCGACCGGTCAGGTCCCCTGGGCTCACGCAAGCGCACTGCCGACGACGTCATCAAACCCCCCGACTACGGC
AGGCTTAACAAGGCCAAGATGAAGCCCTCCAAGGGCACTCTGGTGGCGCAATGGGAGCCCAAGGCGGGTCAAGAC
TTGTGCCCTTGGGTCTTGACAGATCATGCCAGTGAGGCCAATATGGCGGTTCGGCTGCATAAAGAAATCGTCGAC
TTTTACGAATTTGTTCGGCCCAAAAAGTTTGAGCAGCGCATTCGCGAAAATCTGGTGCAAAACTTGCAAAAAGCC
ATGCGTCGCGACCCACGCTTCTCGTCGGCCAAGATACATGCGTTTGGCTCCTACATGTCGGGCCTGTACCTGCCA
ACAGCTGACATGGACCTTGTCGTTTGCTCGGCTAGCTACATGTCTGGAGGGCCACCAACCTTTCTCGGCGCAAGG
TCTTGGCTGCACAAGTTTGCCCAGTTTCTTGTTGTGCAGAAAATGTCAGAAAAAGAAAACGTTGAAGTTATTGCG
CGAGCTCGTGTTCCGCTGGTCAAGTTTGTCGACACCTTGACTGGCCTCAGGGTCGACGTTTCCTTTGAAAACTTG
GGCGGCGTCCAGGCAATTGATACCTTTTTGCAATGGAAGGCCGACTACCCCGCCATGCCAGCGCTTGTGACGGTC
GTCAAGCACTTTCTGCTCATGCGTGGTCTTAATGAGCCGGTCAATGGCGGCATTGGAGGCTTCTCAGTCATTTGC
CTTGTTGTCAGCATGCTTCAAGTGCTGCCGCACATTCAGAGCCGCAGCGCTCCTAGCGCCCATCACTTGGGGGAG
CTGCTTCTAATATTTTTTGAACTCTATGGCCGCCATTTTCGGTACGATAAAGTTGCCATTTCGCTCAGGGATCCC
ATTGGCTATGTACGAAAGTCGGAAGTCTTGAGTTTGACATATCGCAACACGGACAGACTGTCTATTATTGACCCC
AACAATGCATCAAATGACATTACAGGAGGCGCGTCCAACACGGGCGCCATACTGAGCTGCTTCCACGATGCCTTT
GTTGCTCTGACTGAGCGGATGCGAGAGGTGGCCCAGCAGCCAGGAAACGGGGGTATCCTCGACGTACTATTGGAA
GGGGATTACTCATCGTTTCGAATGCAACGACGGTATCTGAAGCACGTTTACGAAGGCGTGTTTGGGCCCTGTCGT
GACGAATGA
Transcript >OphauB2|4572
ATGTCTAGACGCAACGAACCGCCCTCGCGGCGTGGCGACGATCTTTACGATAGCTGGCGCCCGCTCAGCAATCAC
CATAGCCACGATTCTTATCGAGCAGGAGCAGACTCGCATCGGCCGTCGCAACCACATCGAGCATACGAGTCGTAT
CGCCCATCGGGTCACTCTGCCCCCGAGTCTCGCGGCCGCTTCTCCCAGCAGGCCTACCAACAGCCCCAACCTCCA
CAGTCAGATTTCACCTTTCGCCTCGATTATCCTCACACAAGCTTCACTCCCATCAATCCGAGAGCAGATAGGCCC
GGCCAAGGGCCGCGCAGGTCTGATCGTGACCGGTCTAGGCGCTTGCCCATAGCGCATAAGCGTCCTCGCTGGAAA
CCTCCCCATCCCTCTGAGCGTGCCTTGATCTCTGGCGACACGTACGTACAGCCCAGCGAGCGTCTCCACGAGAAC
GGTGCCAAGTTTCGCAACCCCGACGACCTGTCTGACGACGACGAGGTTGATATGATCATATCGTCGTCTGAATCT
GCATCTGACAAGCCCCCCAAGAAGCGGGTGCGAATAGACGCCAACGTGGATAATGACGATGCTCCTAAGTGGTCC
AATCCTGATCCATATACGGCGCTTCCATGCCCCGACGAGACACGACGCAGGAAGCCTGATGTGGTACAGCTGATT
CGCAAGGCTCGTGTTGAAGAAACTAAGCCAGTTGTTGAGACTGTCCCCGAGGCTGAAAATTTTTTGTCGTTTGAT
CTTTCGGCTAGTGAGGGTGAGGCCAACGAGTCGCTACCCACCACCAAGAGCTCTCTCCCAGGCTCGCATTCACGG
CCACCCAATCTTCCGCCCCGCCCCCCAGTCTCAGAGGTGCTCCCCACTCCTGTGACCAAGGTCAACAGGCCATTG
GCCCCCGACCGGTCAGGTCCCCTGGGCTCACGCAAGCGCACTGCCGACGACGTCATCAAACCCCCCGACTACGGC
AGGCTTAACAAGGCCAAGATGAAGCCCTCCAAGGGCACTCTGGTGGCGCAATGGGAGCCCAAGGCGGGTCAAGAC
TTGTGCCCTTGGGTCTTGACAGATCATGCCAGTGAGGCCAATATGGCGGTTCGGCTGCATAAAGAAATCGTCGAC
TTTTACGAATTTGTTCGGCCCAAAAAGTTTGAGCAGCGCATTCGCGAAAATCTGGTGCAAAACTTGCAAAAAGCC
ATGCGTCGCGACCCACGCTTCTCGTCGGCCAAGATACATGCGTTTGGCTCCTACATGTCGGGCCTGTACCTGCCA
ACAGCTGACATGGACCTTGTCGTTTGCTCGGCTAGCTACATGTCTGGAGGGCCACCAACCTTTCTCGGCGCAAGG
TCTTGGCTGCACAAGTTTGCCCAGTTTCTTGTTGTGCAGAAAATGTCAGAAAAAGAAAACGTTGAAGTTATTGCG
CGAGCTCGTGTTCCGCTGGTCAAGTTTGTCGACACCTTGACTGGCCTCAGGGTCGACGTTTCCTTTGAAAACTTG
GGCGGCGTCCAGGCAATTGATACCTTTTTGCAATGGAAGGCCGACTACCCCGCCATGCCAGCGCTTGTGACGGTC
GTCAAGCACTTTCTGCTCATGCGTGGTCTTAATGAGCCGGTCAATGGCGGCATTGGAGGCTTCTCAGTCATTTGC
CTTGTTGTCAGCATGCTTCAAGTGCTGCCGCACATTCAGAGCCGCAGCGCTCCTAGCGCCCATCACTTGGGGGAG
CTGCTTCTAATATTTTTTGAACTCTATGGCCGCCATTTTCGGTACGATAAAGTTGCCATTTCGCTCAGGGATCCC
ATTGGCTATGTACGAAAGTCGGAAGTCTTGAGTTTGACATATCGCAACACGGACAGACTGTCTATTATTGACCCC
AACAATGCATCAAATGACATTACAGGAGGCGCGTCCAACACGGGCGCCATACTGAGCTGCTTCCACGATGCCTTT
GTTGCTCTGACTGAGCGGATGCGAGAGGTGGCCCAGCAGCCAGGAAACGGGGGTATCCTCGACGTACTATTGGAA
GGGGATTACTCATCGTTTCGAATGCAACGACGGTATCTGAAGCACGTTTACGAAGGCGTGTTTGGGCCCTGTCGT
GACGAATGA
Gene >OphauB2|4572
ATGTCTAGACGCAACGAACCGCCCTCGCGGCGTGGCGACGATCTTTACGATAGCTGGCGCCCGCTCAGCAATCAC
CATAGCCACGATTCTTATCGAGCAGGAGCAGACTCGCATCGGCCGTCGCAACCACATCGAGCATACGAGTCGTAT
CGCCCATCGGGTCACTCTGCCCCCGAGTCTCGCGGCCGCTTCTCCCAGCAGGCCTACCAACAGCCCCAACCTCCA
CAGTCAGATTTCACCTTTCGCCTCGATTATCCTCACACAAGCTTCACTCCCATCAATCCGAGAGCAGATAGGCCC
GGCCAAGGGCCGCGCAGGTCTGATCGTGACCGGTCTAGGCGCTTGCCCATAGCGCATAAGCGTCCTCGCTGGAAA
CCTCCCCATCCCTCTGAGCGTGCCTTGATCTCTGGCGACACGTACGTACAGCCCAGCGAGCGTCTCCACGAGAAC
GGTGCCAAGTTTCGCAACCCCGACGACCTGTCTGACGACGACGAGGTTGATATGATCATATCGTCGTCTGAATCT
GCATCTGACAAGCCCCCCAAGAAGCGGGTGCGAATAGACGCCAACGTGGATAATGACGATGCTCCTAAGTGGTCC
AATCCTGATCCATATACGGCGCTTCCATGCCCCGACGAGACACGACGCAGGAAGCCTGATGTGGTACAGCTGATT
CGCAAGGCTCGTGTTGAAGAAACTAAGCCAGTTGTTGAGACTGTCCCCGAGGCTGAAAATTTTTTGTCGTTTGAT
CTTTCGGCTAGTGAGGGTGAGGCCAACGAGTCGCTACCCACCACCAAGAGCTCTCTCCCAGGCTCGCATTCACGG
CCACCCAATCTTCCGCCCCGCCCCCCAGTCTCAGAGGTGCTCCCCACTCCTGTGACCAAGGTCAACAGGCCATTG
GCCCCCGACCGGTCAGGTCCCCTGGGCTCACGCAAGCGCACTGCCGACGACGTCATCAAACCCCCCGACTACGGC
AGGCTTAACAAGGCCAAGATGAAGCCCTCCAAGGGCACTCTGGTGGCGCAATGGGAGCCCAAGGCGGGTCAAGAC
TTGTGCCCTTGGGTCTTGACAGATCATGCCAGTGAGGCCAATATGGCGGTTCGGTAGGCCAGCACCGATTCTTGC
AAGTCTATGCACCGTTCTTGTTGCTTACCCCGCAGCAGGCTGCATAAAGAAATCGTCGACTTTTACGAATTTGTT
CGGCCCAAAAAGTTTGAGCAGCGCATTCGCGAAAATCTGGTGCAAAACTTGCAAAAAGCCATGCGTCGCGACCCA
CGCTTCTCGTCGGCCAAGATACATGCGTTTGGCTCCTACATGTCGGGCCTGTACCTGCCAACAGCTGACATGGAC
CTTGTCGTTTGCTCGGCTAGCTACATGTCTGGAGGGCCACCAACCTTTCTCGGCGCAAGGTCTTGGCTGCACAAG
TTTGCCCAGTTTCTTGTTGTGCAGAAAATGTCAGAAAAAGAAAACGTTGAAGTTATTGCGCGAGCTCGTGTTCCG
CTGGTCAAGTTTGTCGACACCTTGACTGGCCTCAGGGTCGACGTTTCCTTTGAAAACTTGGGCGGCGTCCAGGCA
ATTGATACCTTTTTGCAATGGAAGGCCGACTACCCCGCCATGCCAGCGCTTGTGACGGTCGTCAAGCACTTTCTG
CTCATGCGTGGTCTTAATGAGCCGGTCAATGGCGGCATTGGAGGCTTCTCAGTCATTTGCCTTGTTGTCAGCATG
CTTCAAGTGCTGCCGCACATTCAGAGCCGCAGCGCTCCTAGCGCCCATCACTTGGGGGAGCTGCTTCTAATATTT
TTTGAACTCTATGGCCGCCATTTTCGGTACGATAAAGTTGCCATTTCGCTCAGGGATCCCATTGGCTATGTACGA
AAGGTAGAGAATGGCTGTATCCGTCTTGGTGGTTGCTATCATGTTGCTAATTCCTTGTCCAGTCGGAAGTCTTGA
GTTTGACATATCGCAACACGGACAGACTGTCTATTATTGACCCCAACAATGCATCAAATGACATTACAGGAGGCG
CGTCCAACACGGGCGCCATACTGAGCTGCTTCCACGATGCCTTTGTTGCTCTGACTGAGCGGATGCGAGAGGTGG
CCCAGCAGCCAGGAAACGGGGGTATCCTCGACGTACTATTGGAAGGGGATTACTCATCGTTTCGAATGCAACGAC
GGTATCTGAAGCACGTTTACGAAGGCGTGTTTGGGCCCTGTCGTGACGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail