Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4571
Gene name
LocationContig_30:138564..139793
Strand-
Gene length (bp)1229
Transcript length (bp)1149
Coding sequence length (bp)1149
Protein length (aa) 383

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 4.5E-19 137 294
PF13649 Methyltransf_25 Methyltransferase domain 1.6E-09 145 234
PF13847 Methyltransf_31 Methyltransferase domain 8.7E-08 141 251
PF08241 Methyltransf_11 Methyltransferase domain 2.1E-05 146 236

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4571
MSKSLPQPPERGGDASTPAILDRVSSAADPLQHSASRLSSRAQHTQRDAVDGNDSNSSHEGNADSAYASDSVTAF
TASATSSIFHYRFENGRRYHAYRAGQYLLPNDAQEQERLELQHYIWRLLLNGRLYTAPLPSPSRSPNMRILDLGT
GTGIWAIDMADEFPSAAVAGVDLSPIQPEWVPNNCRFHIDDYEDTWTYSRKERFDYIHGRALGGTSSNWHRFYRQ
VMDNLKPGGWVEMHEYDACIYSQDDSLDRAPCTKEWMHKLDSASKQHGKQINVARFHKEWIAKAGFRHVREDVHM
IPIGSWARDPFLKELGRLEFIHMQMSVDSHTPALFTRILNYSSEQAKDLMEGVKRELRNRDLRLISCYRVIIGQK
AGDCTYN*
Coding >OphauB2|4571
ATGTCTAAATCTTTGCCACAGCCCCCCGAACGAGGTGGCGACGCTTCTACACCAGCCATATTGGACCGAGTGTCG
TCGGCTGCTGATCCACTGCAGCACTCGGCCAGCCGGCTGTCGAGCCGTGCCCAACATACCCAGCGTGATGCTGTA
GACGGCAATGACTCCAACAGCTCCCATGAAGGCAATGCCGACTCAGCATATGCCTCGGACAGCGTCACTGCCTTT
ACTGCGTCTGCCACGTCGTCCATCTTCCACTACCGCTTCGAAAATGGACGCCGCTATCATGCATACCGCGCAGGT
CAATACCTCCTTCCCAACGATGCTCAGGAACAGGAACGCCTCGAGCTGCAACACTACATCTGGCGGCTTCTCCTC
AATGGACGCCTCTACACAGCGCCATTACCATCTCCTAGCCGCAGTCCAAACATGCGCATCCTCGACCTCGGCACC
GGCACCGGCATCTGGGCCATTGATATGGCTGATGAATTCCCTTCGGCCGCGGTTGCCGGCGTTGACCTTTCACCA
ATACAGCCCGAGTGGGTTCCCAACAATTGTCGGTTTCACATTGACGATTATGAAGATACATGGACCTATAGTCGT
AAGGAGCGCTTTGATTATATTCATGGCCGAGCCCTCGGCGGCACCAGCTCCAACTGGCACCGCTTCTACCGCCAG
GTCATGGACAATTTGAAACCGGGAGGCTGGGTCGAGATGCATGAGTACGATGCATGCATATACAGCCAGGATGAC
AGCCTCGACCGTGCCCCGTGTACCAAAGAATGGATGCACAAGCTGGACTCGGCCAGCAAGCAGCACGGCAAGCAA
ATCAACGTTGCCCGTTTCCACAAGGAATGGATAGCCAAAGCTGGCTTCCGCCATGTTCGCGAGGACGTGCACATG
ATACCCATCGGTTCCTGGGCTAGGGATCCTTTCCTCAAGGAGCTCGGCCGTCTCGAATTCATTCACATGCAAATG
TCGGTCGACTCGCACACCCCGGCCCTTTTTACCCGAATTCTCAACTACTCGTCGGAGCAGGCTAAAGATTTGATG
GAGGGTGTCAAGCGCGAGCTACGTAACCGAGATTTACGTCTCATTTCCTGCTATCGCGTAATCATTGGCCAGAAG
GCAGGCGACTGCACCTACAACTGA
Transcript >OphauB2|4571
ATGTCTAAATCTTTGCCACAGCCCCCCGAACGAGGTGGCGACGCTTCTACACCAGCCATATTGGACCGAGTGTCG
TCGGCTGCTGATCCACTGCAGCACTCGGCCAGCCGGCTGTCGAGCCGTGCCCAACATACCCAGCGTGATGCTGTA
GACGGCAATGACTCCAACAGCTCCCATGAAGGCAATGCCGACTCAGCATATGCCTCGGACAGCGTCACTGCCTTT
ACTGCGTCTGCCACGTCGTCCATCTTCCACTACCGCTTCGAAAATGGACGCCGCTATCATGCATACCGCGCAGGT
CAATACCTCCTTCCCAACGATGCTCAGGAACAGGAACGCCTCGAGCTGCAACACTACATCTGGCGGCTTCTCCTC
AATGGACGCCTCTACACAGCGCCATTACCATCTCCTAGCCGCAGTCCAAACATGCGCATCCTCGACCTCGGCACC
GGCACCGGCATCTGGGCCATTGATATGGCTGATGAATTCCCTTCGGCCGCGGTTGCCGGCGTTGACCTTTCACCA
ATACAGCCCGAGTGGGTTCCCAACAATTGTCGGTTTCACATTGACGATTATGAAGATACATGGACCTATAGTCGT
AAGGAGCGCTTTGATTATATTCATGGCCGAGCCCTCGGCGGCACCAGCTCCAACTGGCACCGCTTCTACCGCCAG
GTCATGGACAATTTGAAACCGGGAGGCTGGGTCGAGATGCATGAGTACGATGCATGCATATACAGCCAGGATGAC
AGCCTCGACCGTGCCCCGTGTACCAAAGAATGGATGCACAAGCTGGACTCGGCCAGCAAGCAGCACGGCAAGCAA
ATCAACGTTGCCCGTTTCCACAAGGAATGGATAGCCAAAGCTGGCTTCCGCCATGTTCGCGAGGACGTGCACATG
ATACCCATCGGTTCCTGGGCTAGGGATCCTTTCCTCAAGGAGCTCGGCCGTCTCGAATTCATTCACATGCAAATG
TCGGTCGACTCGCACACCCCGGCCCTTTTTACCCGAATTCTCAACTACTCGTCGGAGCAGGCTAAAGATTTGATG
GAGGGTGTCAAGCGCGAGCTACGTAACCGAGATTTACGTCTCATTTCCTGCTATCGCGTAATCATTGGCCAGAAG
GCAGGCGACTGCACCTACAACTGA
Gene >OphauB2|4571
ATGTCTAAATCTTTGCCACAGCCCCCCGAACGAGGTGGCGACGCTTCTACACCAGCCATATTGGACCGAGTGTCG
TCGGCTGCTGATCCACTGCAGCACTCGGCCAGCCGGCTGTCGAGCCGTGCCCAACATACCCAGCGTGATGCTGTA
GACGGCAATGACTCCAACAGCTCCCATGAAGGCAATGCCGACTCAGCATATGCCTCGGACAGCGTCACTGCCTTT
ACTGCGTCTGCCACGTCGTCCATCTTCCACTACCGCTTCGAAAATGGACGCCGCTATCATGCATACCGCGCAGGT
CAATACCTCCTTCCCAACGATGCTCAGGAACAGGAACGCCTCGAGCTGCAACACTACATCTGGCGGCTTCTCCTC
AATGGACGCCTCTACACAGCGCCATTACCATCTCCTAGCCGCAGTCCAAACATGCGCATCCTCGACCTCGGCACC
GGCACCGGCATCTGGGCCATTGATATGGCTGATGAATTCCCTTCGGCCGCGGTTGCCGGCGTTGACCTTTCACCA
ATACAGCCCGAGTGGGTTCCCAACAATTGTCGGTTTCACATTGACGATTATGAAGATACATGGACCTATAGTCGT
AAGGAGCGCTTTGATTATATTCATGGCCGAGCCCTCGGCGGCACCAGCTCCAACTGGCACCGCTTCTACCGCCAG
GTCATGGACAATTTGAAACCGGGAGGCTGGGTCGAGATGCATGAGTACGATGCATGCATATACAGCCAGGATGAC
AGCCTCGACCGTGCCCCGTGTACCAAAGAATGGATGCACAAGCTGGACTCGGCCAGCAAGCAGCACGGCAAGCAA
ATCAACGTTGCCCGTTTCCACAAGGAATGGATAGCCAAAGCTGGCTTCCGCCATGTTCGCGAGGACGTGCACATG
GTCTGTCGCACCTTGCTCACGTCTATCCGTCTTATTACCTACCTTGTTTCTTGTTTTCTGTTGCCAACTCACTCC
TTCAGATACCCATCGGTTCCTGGGCTAGGGATCCTTTCCTCAAGGAGCTCGGCCGTCTCGAATTCATTCACATGC
AAATGTCGGTCGACTCGCACACCCCGGCCCTTTTTACCCGAATTCTCAACTACTCGTCGGAGCAGGCTAAAGATT
TGATGGAGGGTGTCAAGCGCGAGCTACGTAACCGAGATTTACGTCTCATTTCCTGCTATCGCGTAATCATTGGCC
AGAAGGCAGGCGACTGCACCTACAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail