Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|457
Gene name
LocationContig_106:64597..66860
Strand-
Gene length (bp)2263
Transcript length (bp)1596
Coding sequence length (bp)1596
Protein length (aa) 532

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.7E-40 94 481
PF00083 Sugar_tr Sugar (and other) transporter 3.7E-06 97 514

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 47 528 5.0E-123
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 12 531 2.0E-93
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 58 530 6.0E-91
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 6 528 2.0E-85
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 69 528 1.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 47 528 5.0E-123
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 12 531 2.0E-93
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 58 530 6.0E-91
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 6 528 2.0E-85
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 69 528 1.0E-83
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 13 530 3.0E-83
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 23 530 3.0E-83
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 19 529 4.0E-83
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 25 528 1.0E-80
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 44 529 2.0E-79
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 63 529 2.0E-79
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 63 529 2.0E-79
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 26 528 3.0E-78
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 49 525 5.0E-78
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 8 526 5.0E-78
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 72 530 3.0E-76
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 52 531 3.0E-76
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 18 531 9.0E-76
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 47 524 1.0E-75
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 70 524 2.0E-75
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 53 522 1.0E-73
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 83 530 3.0E-73
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 53 522 6.0E-73
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 57 527 5.0E-68
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 46 527 5.0E-67
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 28 530 4.0E-51
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 10 530 4.0E-48
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 25 528 4.0E-46
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 77 284 7.0E-25
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 373 522 9.0E-24
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 24 516 2.0E-23
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 23 531 8.0E-20
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 66 526 5.0E-18
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 9 522 4.0E-16
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 1 264 2.0E-15
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 382 524 2.0E-12
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 80 266 9.0E-12
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 43 478 6.0E-11
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 24 265 1.0E-10
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 87 283 5.0E-09
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 104 248 1.0E-08
sp|P31442|EMRD_ECOLI Multidrug resistance protein D OS=Escherichia coli (strain K12) GN=emrD PE=1 SV=2 101 264 3.0E-08
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 305 478 3.0E-08
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 60 245 1.0E-07
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 80 263 2.0E-07
sp|Q1RI77|BCRH_RICBR Uncharacterized transporter RBE_0856 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0856 PE=3 SV=1 85 264 2.0E-07
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 88 263 3.0E-07
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 88 263 4.0E-07
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 58 264 5.0E-07
sp|Q7Z118|YMPB_CAEEL Putative transporter B0361.11 OS=Caenorhabditis elegans GN=B0361.11 PE=3 SV=2 126 279 5.0E-07
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 144 247 1.0E-06
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 144 245 2.0E-06
sp|P40760|YUXJ_BACSU Uncharacterized MFS-type transporter YuxJ OS=Bacillus subtilis (strain 168) GN=yuxJ PE=3 SV=3 116 245 4.0E-06
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 85 320 4.0E-06
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 91 240 5.0E-06
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 104 279 5.0E-06
sp|P32482|CMLA_PSEAI Chloramphenicol resistance protein OS=Pseudomonas aeruginosa GN=cmlA PE=3 SV=2 125 240 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006810 transport No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 85 107 22
2 122 144 22
3 156 178 22
4 182 204 22
5 211 233 22
6 248 270 22
7 319 341 22
8 356 378 22
9 405 427 22
10 432 454 22
11 461 483 22
12 493 515 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup127
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2200
Ophiocordyceps australis 1348a (Ghana) OphauG2|3004
Ophiocordyceps australis 1348a (Ghana) OphauG2|5103
Ophiocordyceps australis map64 (Brazil) OphauB2|457 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5161
Ophiocordyceps camponoti-floridani Ophcf2|06511
Ophiocordyceps camponoti-rufipedis Ophun1|7410
Ophiocordyceps kimflemingae Ophio5|7235
Ophiocordyceps subramaniannii Hirsu2|10240
Ophiocordyceps subramaniannii Hirsu2|10299
Ophiocordyceps subramaniannii Hirsu2|10949
Ophiocordyceps subramaniannii Hirsu2|5047
Ophiocordyceps subramaniannii Hirsu2|7256

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|457
MLHGPHSRPHAHQQHKSTLSEPIKDPNNAHEQQPRGPQAGFAMSDTEVDAAPSTEKDKDASEVGWEPSDTADPLC
PRSFSRRRKWLIVCILASVSLAVTCASSIYTATYDRMEADFHNSRIVSVLGLSSFVLGISIGPMFLSPLSEFYGR
RPIYLVAWAAYTIFLVPQALAHSVALVIVFRFLDGFTGSAFLAVAGGTVGDLFSKDELQAPMAVFSVAPFIGPSL
GPLLGGFINYNVTWRWTYYLLLIWSGFILVAVALFVPETYHPILLRNKARKLRKETGDEHWIAPTEHVQKSVPRA
IGRSLLRPFQLLIFEPMCLNLCILSALLLGILYLFFGAFPLIFGTAHAFNRWQTGLAFLGIMVSMVVGVATDPIW
HRIRSRLIIRHRRQTNGVEGSEPEFRLPPAIFGSVCVPAGLFMFGWSTYPWVHWIVPIIGSAIFGLGIMLLFTGI
FTFLVDAYPQYAASALAANAFVRCLFAAAFPLFGNQMYKRLGYQWASSLLAFLTLIMMPFPYIFFRYGKRIRAKS
RFASKA*
Coding >OphauB2|457
ATGCTGCATGGGCCACACTCAAGGCCACACGCCCACCAGCAGCACAAGTCGACTCTGAGCGAGCCCATCAAGGAC
CCCAATAATGCCCACGAACAGCAGCCTCGGGGCCCGCAGGCAGGATTTGCCATGTCTGACACCGAGGTTGACGCG
GCGCCCAGCACCGAAAAAGACAAAGACGCCTCCGAGGTGGGCTGGGAGCCAAGCGACACTGCCGATCCGCTGTGC
CCCCGAAGCTTCTCTCGCCGCCGAAAGTGGCTGATTGTATGCATCCTGGCCAGCGTCAGTCTTGCTGTCACCTGT
GCCAGTTCCATATATACAGCCACGTACGACAGGATGGAGGCCGATTTTCACAACTCGCGCATCGTCTCCGTCCTC
GGCCTGTCTTCTTTTGTTCTGGGCATCAGCATTGGGCCCATGTTTCTCAGCCCGCTTAGCGAGTTCTATGGCCGC
CGCCCCATCTATCTTGTCGCTTGGGCCGCATATACCATTTTTCTCGTGCCTCAAGCCCTGGCCCACAGCGTCGCC
CTCGTCATCGTCTTTCGCTTCTTGGATGGCTTCACCGGCTCTGCCTTTCTTGCTGTCGCCGGCGGCACTGTCGGA
GACCTTTTCTCAAAGGACGAGTTGCAGGCGCCCATGGCCGTCTTCTCTGTTGCGCCCTTCATTGGCCCCAGCTTG
GGCCCTCTGCTCGGTGGCTTCATCAACTACAACGTCACTTGGCGATGGACATATTATCTTCTTCTCATCTGGTCA
GGCTTCATCTTGGTTGCTGTTGCCCTTTTTGTTCCAGAGACGTACCACCCCATATTGCTGCGCAACAAGGCGCGC
AAGTTGCGAAAGGAGACGGGCGACGAGCACTGGATTGCTCCCACTGAACATGTACAAAAGTCGGTTCCTCGCGCC
ATTGGCCGCTCGCTGTTGCGGCCCTTTCAACTGCTCATCTTTGAGCCCATGTGCCTCAACCTGTGCATCCTCTCG
GCGCTGCTCCTGGGAATTCTCTATCTTTTTTTTGGCGCCTTTCCTCTGATATTTGGTACGGCACACGCTTTCAAT
CGCTGGCAAACTGGTCTGGCCTTCCTCGGCATCATGGTGTCCATGGTGGTGGGCGTTGCCACCGATCCTATCTGG
CATCGCATTCGGTCCCGCCTCATCATTCGTCATCGCCGCCAAACAAATGGTGTCGAGGGCAGCGAGCCCGAGTTT
CGATTGCCGCCAGCCATCTTTGGCTCCGTTTGCGTGCCCGCCGGGCTCTTCATGTTTGGCTGGTCCACCTACCCC
TGGGTGCATTGGATAGTTCCCATTATTGGATCAGCCATTTTTGGCCTCGGAATAATGTTGCTCTTTACCGGAATT
TTTACCTTTTTGGTCGATGCCTATCCGCAGTACGCCGCGAGTGCTCTCGCTGCCAACGCATTTGTGCGCTGCCTT
TTTGCAGCGGCATTTCCCCTGTTCGGCAACCAGATGTACAAACGGCTAGGTTACCAATGGGCTTCGTCGCTCCTC
GCCTTCCTCACCCTCATTATGATGCCCTTTCCCTACATCTTCTTCCGCTACGGCAAACGCATCAGGGCAAAGAGC
CGATTTGCCAGCAAAGCCTAA
Transcript >OphauB2|457
ATGCTGCATGGGCCACACTCAAGGCCACACGCCCACCAGCAGCACAAGTCGACTCTGAGCGAGCCCATCAAGGAC
CCCAATAATGCCCACGAACAGCAGCCTCGGGGCCCGCAGGCAGGATTTGCCATGTCTGACACCGAGGTTGACGCG
GCGCCCAGCACCGAAAAAGACAAAGACGCCTCCGAGGTGGGCTGGGAGCCAAGCGACACTGCCGATCCGCTGTGC
CCCCGAAGCTTCTCTCGCCGCCGAAAGTGGCTGATTGTATGCATCCTGGCCAGCGTCAGTCTTGCTGTCACCTGT
GCCAGTTCCATATATACAGCCACGTACGACAGGATGGAGGCCGATTTTCACAACTCGCGCATCGTCTCCGTCCTC
GGCCTGTCTTCTTTTGTTCTGGGCATCAGCATTGGGCCCATGTTTCTCAGCCCGCTTAGCGAGTTCTATGGCCGC
CGCCCCATCTATCTTGTCGCTTGGGCCGCATATACCATTTTTCTCGTGCCTCAAGCCCTGGCCCACAGCGTCGCC
CTCGTCATCGTCTTTCGCTTCTTGGATGGCTTCACCGGCTCTGCCTTTCTTGCTGTCGCCGGCGGCACTGTCGGA
GACCTTTTCTCAAAGGACGAGTTGCAGGCGCCCATGGCCGTCTTCTCTGTTGCGCCCTTCATTGGCCCCAGCTTG
GGCCCTCTGCTCGGTGGCTTCATCAACTACAACGTCACTTGGCGATGGACATATTATCTTCTTCTCATCTGGTCA
GGCTTCATCTTGGTTGCTGTTGCCCTTTTTGTTCCAGAGACGTACCACCCCATATTGCTGCGCAACAAGGCGCGC
AAGTTGCGAAAGGAGACGGGCGACGAGCACTGGATTGCTCCCACTGAACATGTACAAAAGTCGGTTCCTCGCGCC
ATTGGCCGCTCGCTGTTGCGGCCCTTTCAACTGCTCATCTTTGAGCCCATGTGCCTCAACCTGTGCATCCTCTCG
GCGCTGCTCCTGGGAATTCTCTATCTTTTTTTTGGCGCCTTTCCTCTGATATTTGGTACGGCACACGCTTTCAAT
CGCTGGCAAACTGGTCTGGCCTTCCTCGGCATCATGGTGTCCATGGTGGTGGGCGTTGCCACCGATCCTATCTGG
CATCGCATTCGGTCCCGCCTCATCATTCGTCATCGCCGCCAAACAAATGGTGTCGAGGGCAGCGAGCCCGAGTTT
CGATTGCCGCCAGCCATCTTTGGCTCCGTTTGCGTGCCCGCCGGGCTCTTCATGTTTGGCTGGTCCACCTACCCC
TGGGTGCATTGGATAGTTCCCATTATTGGATCAGCCATTTTTGGCCTCGGAATAATGTTGCTCTTTACCGGAATT
TTTACCTTTTTGGTCGATGCCTATCCGCAGTACGCCGCGAGTGCTCTCGCTGCCAACGCATTTGTGCGCTGCCTT
TTTGCAGCGGCATTTCCCCTGTTCGGCAACCAGATGTACAAACGGCTAGGTTACCAATGGGCTTCGTCGCTCCTC
GCCTTCCTCACCCTCATTATGATGCCCTTTCCCTACATCTTCTTCCGCTACGGCAAACGCATCAGGGCAAAGAGC
CGATTTGCCAGCAAAGCCTAA
Gene >OphauB2|457
ATGCTGCATGGGCCACACTCAAGGCCACACGCCCACCAGCAGCACAAGTCGACTCTGAGCGAGCCCATCAAGGAC
CCCAATAATGCCCACGAACAGCAGCCTCGGGGCCCGCAGGCAGGATTTGCCATGTCTGACACCGAGGTTGACGCG
GCGCCCAGCACCGAAAAAGACAAAGACGCCTCCGAGGTGGGCTGGGAGCCAAGCGACACTGCCGATCCGCTGTGC
CCCCGAAGCTTCTCTCGCCGCCGAAAGTGGCTGATTGTATGCATCCTGGCCAGCGTCAGTCTTGCTGTGTAAGTC
TTGTTGCAGCCATTGCAGCCTGCAAAGACTGATGCCCTTGCATGTAACAGCACCTGTGCCAGTTCCATATATACA
GCCACGTACGACAGGATGGAGGCCGATTTTCACAACTCGCGCATCGTCTCCGTCCTCGGCCTGTCTTCTTTTGTT
CTGGGCATCAGCATTGGGCCCATGTTTCTCAGCCCGCTTAGCGAGTTCTATGGCCGCCGCCCCATCTATCTTGTC
GCTTGGGCCGCATATACCATTTTTCTCGTGCCTCAAGCCCTGGCCCACAGCGTCGCCCTCGTCATCGTCTTTCGC
TTCTTGGATGGCTTCACCGGCTCTGCCTTTCTTGCTGTCGCCGGCGGCACTGTCGGAGACCTTTTCTCAAAGGAC
GAGTTGCAGGCGCCCATGGCCGTCTTCTCTGTTGCGCCCTTCATTGGCCCCAGCTTGGGCCCTCTGCTCGGTGGC
TTCATCAACTACAACGTCACTTGGCGATGGACATATTATCTTCTTCTCATCTGGTCAGGCTTCATCTTGGTTGCT
GTTGCCCTTTTTGTTCCAGAGACGTACCGTGAGTTGCAGTCATTGCTCCTGTGCCAACTTTGTCCCCTTCAACTG
ACTCTTCATCAAAGACCCCATATTGCTGCGCAACAAGGCGCGCAAGTTGCGAAAGGAGACGGGCGACGAGCACTG
GATTGCTCCCACTGAACATGTACAAAAGTCGGTTCCTCGCGCCATTGGCCGCTCGCTGTTGCGGCCCTTTCAACT
GCTCATCTTTGAGCCCATGTGCCTCAACCTGTGCATCCTCTCGGCGCTGCTCCTGGGAATTCTCTATCTTTTTTT
TGGCGCCTTTCCTCTGATATTTGGTACGGCACACGCTTTCAATCGCTGGCAAACTGGTCTGGCCTTCCTCGGCAT
CATGGTGTCCATGGTGGTGGGCGTTGCCACCGATCCTATCTGGCATCGCATTCGGTCCCGCCTCATCATTCGTCA
TCGCCGCCAAACAAATGGTGTCGAGGGCAGCGAGCCCGAGTTTCGATTGCCGCCAGCCATCTTTGGCTCCGTTTG
CGTGCCCGCCGGGCTCTTCATGTTTGGCTGGTCCACCTACCCCTGGGTGCATTGGATAGTTCCCATTATTGGATC
AGCCATTTTTGGCCTCGGGTGAGTTGGCCCTTCCTTTCGCTTTGCTCCCCCCACACGTCCAAGTCTTGCCATGTC
GCACTGCAGCTCTGCTTGCTTTTCCAAGAGTCCACTTCAGGCCTCGATGCTCTTTACGCCTGATGGAGAGCGGGG
GGTGTGTGTGGCAGCGCACAATGCCAGCTCTCTCCACTTGTGTCAGGACGGAAGCCCCTTTTCGGAGCATTTGTC
TTTTGTTCGCTCCGCACACAGGCCACAGTTTTTGCCATGTTTCAATAACTGACAATGCAGTTGGAGGCAGAATAA
TGTTGCTCTTTACCGGAATTTTTACCTTTTTGGCAAGTGGTGCCGTGAATAAGGAGCGTGTCCTGGCCACTTACT
TGGCTGACTGGTTCTTTGGCGCCGACAGGTCGATGCCTATCCGCAGTACGCCGCGAGTGCTCTCGCTGCCAACGC
ATTTGTGCGCTGCCTTTTTGCAGGTGAGTCGGCCGAGACGACTGCCCCTGTTACCCCTTGCTTCTTTGCCCTCCC
TGGCACCTGGCTTTGTTTGGCTGCTGCCCCTGTGGGAGATGCTCGGTTGTGTCTGCTGTTCAACGTTGCACGAGT
TGCGCCCAGACGTATACTTTTTTCCGTATACATGTCAGTGATGCTAATCTGAGCCACCTATGGGTCCATGGCAGC
GGCATTTCCCCTGTTCGGCAACCAGATGTACAAACGGCTAGGTTACCAATGGGCTTCGTCGCTCCTCGCCTTCCT
CACCCTCATTATGATGCCCTTTCCCTACATCTTCTTCCGCTACGGCAAACGCATCAGGGCAAAGAGCCGATTTGC
CAGCAAAGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail