Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4564
Gene name
LocationContig_30:123814..125274
Strand+
Gene length (bp)1460
Transcript length (bp)1200
Coding sequence length (bp)1200
Protein length (aa) 400

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 1.6E-17 234 378

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 32 397 2.0E-40
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 23 397 6.0E-40
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 10 374 2.0E-22
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 40 374 9.0E-21
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 62 384 6.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 32 397 2.0E-40
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 23 397 6.0E-40
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 10 374 2.0E-22
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 40 374 9.0E-21
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 62 384 6.0E-17
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 95 380 2.0E-16
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 202 399 1.0E-15
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 202 399 2.0E-15
sp|O22308|7OMT6_MEDSA Isoflavone-7-O-methyltransferase 6 OS=Medicago sativa PE=2 SV=1 162 379 3.0E-15
sp|O24529|7OMT8_MEDSA Isoflavone-7-O-methyltransferase 8 OS=Medicago sativa PE=1 SV=1 162 379 3.0E-15
sp|C6TAY1|SOMT2_SOYBN Flavonoid 4'-O-methyltransferase OS=Glycine max PE=1 SV=1 178 388 7.0E-15
sp|O22309|7OMT9_MEDSA Isoflavone-7-O-methyltransferase 9 OS=Medicago sativa PE=2 SV=1 162 389 1.0E-14
sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 162 379 2.0E-13
sp|Q6T1F6|BMT_AMMMJ Bergaptol O-methyltransferase OS=Ammi majus GN=BMT PE=1 SV=1 174 379 3.0E-13
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 234 399 4.0E-13
sp|P93324|CHOMT_MEDSA Isoliquiritigenin 2'-O-methyltransferase OS=Medicago sativa PE=1 SV=1 234 384 4.0E-13
sp|A8J6X1|BMT_GLELI Bergaptol O-methyltransferase OS=Glehnia littoralis GN=BMT PE=1 SV=1 174 379 1.0E-12
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 189 395 3.0E-12
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 230 392 3.0E-11
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 230 394 4.0E-11
sp|Q8H9A8|COOMT_COPJA Columbamine O-methyltransferase OS=Coptis japonica PE=1 SV=1 231 398 1.0E-10
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 160 395 1.0E-10
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 172 381 2.0E-10
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 175 385 3.0E-10
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 220 385 8.0E-10
sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 233 384 3.0E-09
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 96 384 3.0E-09
sp|B6VJS4|ROMT_VITVI Trans-resveratrol di-O-methyltransferase OS=Vitis vinifera GN=ROMT PE=1 SV=2 164 379 5.0E-09
sp|Q43239|COMT1_ZINVI Caffeic acid 3-O-methyltransferase OS=Zinnia violacea PE=2 SV=1 235 379 6.0E-09
sp|P45986|IMT1_MESCR Inositol 4-methyltransferase OS=Mesembryanthemum crystallinum GN=IMT1 PE=1 SV=1 154 384 7.0E-09
sp|Q9FQY8|COMT1_CAPAN Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2 234 383 1.0E-08
sp|A8QW52|OMT1_SORBI Eugenol O-methyltransferase OS=Sorghum bicolor GN=EOMT PE=1 SV=1 235 379 2.0E-08
sp|Q43046|COMT1_POPKI Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1 233 379 5.0E-08
sp|Q41086|COMT2_POPTM Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1 234 379 9.0E-08
sp|O04385|IEMT_CLABR (Iso)eugenol O-methyltransferase OS=Clarkia breweri GN=IEMT1 PE=1 SV=2 236 379 1.0E-07
sp|Q7XXD4|METL_ORYSJ Probable inactive methyltransferase Os04g0175900 OS=Oryza sativa subsp. japonica GN=Os04g0175900 PE=1 SV=2 175 379 2.0E-07
sp|Q9SWC2|COMT1_EUCGL Caffeic acid 3-O-methyltransferase (Fragment) OS=Eucalyptus globulus GN=COMT1 PE=3 SV=1 236 366 3.0E-07
sp|O23760|COMT1_CLABR Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1 235 379 3.0E-07
sp|B4XY98|AZIB2_STREG 3-hydroxy-5-methyl-1-naphthoate 3-O-methyltransferase OS=Streptomyces sahachiroi GN=aziB2 PE=1 SV=1 235 390 4.0E-07
sp|Q93WU3|CVMT1_OCIBA Chavicol O-methyltransferase OS=Ocimum basilicum GN=CVOMT1 PE=1 SV=1 231 379 6.0E-07
sp|Q39522|SMT_COPJA (S)-scoulerine 9-O-methyltransferase OS=Coptis japonica GN=SMT PE=1 SV=1 168 394 6.0E-07
sp|Q93WU2|EOMT1_OCIBA Eugenol O-methyltransferase OS=Ocimum basilicum GN=EOMT1 PE=1 SV=1 234 379 7.0E-07
sp|B0CN39|SFMM3_STRLA O-methyltransferase SfmM3 OS=Streptomyces lavendulae GN=sfmM3 PE=3 SV=1 236 390 8.0E-07
sp|Q54B60|OMT11_DICDI Probable inactive O-methyltransferase 11 OS=Dictyostelium discoideum GN=omt11 PE=3 SV=1 189 390 1.0E-06
sp|P46597|ASMT_HUMAN Acetylserotonin O-methyltransferase OS=Homo sapiens GN=ASMT PE=1 SV=1 236 386 3.0E-06
sp|Q6VMW0|Q8OMT_MENPI 8-hydroxyquercetin 8-O-methyltransferase OS=Mentha piperita GN=OMT2 PE=1 SV=1 231 386 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008168 methyltransferase activity No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895
Ophiocordyceps australis 1348a (Ghana) OphauG2|266
Ophiocordyceps australis map64 (Brazil) OphauB2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012
Ophiocordyceps australis map64 (Brazil) OphauB2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|4564 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7299
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000
Ophiocordyceps subramaniannii Hirsu2|8115
Ophiocordyceps subramaniannii Hirsu2|7926
Ophiocordyceps subramaniannii Hirsu2|6259
Ophiocordyceps subramaniannii Hirsu2|2878
Ophiocordyceps subramaniannii Hirsu2|1201
Ophiocordyceps subramaniannii Hirsu2|11082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4564
MGAILGLQATVPCEVGQLNLGVLEHQLRLLLVKSDSVRVEESQRLEIMGLLQKAARALEEPSETLKRIGSSSLQL
VAAKIGQDHKLYETIVEASEPVGLEQLEHASGIKAETVDCLMEYICTQGMASRNSRGQYEATKLSRLMMEPLTRH
WMTHFHDLMLPSYAALNKSLFQPDGPLAFCLAHGTKQPFYEWLTWHEAYRRAFYGVMEAYTRRGSLWLDVVDFEG
EFGSGDGVAFVDVGGGIGQQCQHLLQRHPTLKGQVVLQDTPDVLKGALRGYGMQTMSYDFFSEQPIKGARVYYLR
QILHNHSDEDCLEILQAQKAGLGASSVLVIDEKVLPDVGSDEEASAEFVATMGINMLVLFRAQERRESHWRRLME
QAGLGVRQVRRYSPGEAMMICASW*
Coding >OphauB2|4564
ATGGGCGCGATTCTCGGACTGCAAGCAACAGTGCCATGCGAGGTTGGCCAACTGAATCTTGGCGTTCTGGAACAT
CAGCTGCGTCTCTTGTTGGTCAAGAGCGATTCTGTGCGGGTTGAGGAGAGCCAGAGGCTCGAGATTATGGGCTTG
CTGCAAAAAGCCGCGCGGGCACTAGAGGAGCCGTCTGAAACTCTCAAGCGCATCGGGAGCTCTAGCCTACAGCTA
GTCGCTGCAAAGATTGGGCAGGACCACAAGCTCTACGAGACAATAGTCGAGGCCAGCGAGCCGGTTGGCCTTGAG
CAGCTTGAGCATGCCAGTGGGATCAAGGCAGAGACTGTCGACTGTCTCATGGAGTACATATGCACACAAGGTATG
GCGTCACGTAACAGTCGAGGCCAATACGAAGCCACCAAGCTGTCACGCCTCATGATGGAGCCTCTGACGCGGCAT
TGGATGACTCACTTCCATGACTTGATGCTTCCTAGCTATGCAGCACTCAACAAGTCCTTGTTCCAGCCAGATGGC
CCCCTGGCGTTTTGCCTAGCACACGGAACCAAGCAGCCGTTTTACGAGTGGCTGACTTGGCACGAGGCGTACCGA
CGCGCCTTTTACGGAGTCATGGAGGCTTACACACGCCGAGGCTCCTTGTGGCTCGACGTGGTCGACTTTGAAGGC
GAGTTTGGCAGCGGTGACGGGGTTGCCTTTGTCGACGTTGGCGGGGGCATTGGCCAGCAGTGTCAGCATTTGCTG
CAGAGGCATCCTACGCTCAAGGGCCAAGTGGTGCTTCAAGACACGCCAGATGTGCTGAAAGGAGCGTTGCGCGGC
TACGGCATGCAGACAATGAGCTACGACTTTTTCTCGGAGCAGCCAATCAAGGGCGCTCGAGTCTATTACCTGCGG
CAGATTCTACACAACCACTCGGACGAGGACTGTCTTGAAATCCTGCAGGCGCAAAAGGCAGGTCTCGGCGCCAGC
AGCGTGCTTGTCATTGATGAAAAGGTGCTGCCGGATGTGGGGTCGGACGAGGAGGCGTCGGCCGAGTTTGTGGCT
ACCATGGGAATAAACATGCTGGTACTGTTTCGGGCGCAGGAGCGACGAGAATCGCATTGGCGGCGGCTGATGGAG
CAGGCAGGGCTTGGGGTGCGTCAAGTGCGCCGCTATTCGCCGGGGGAAGCCATGATGATTTGTGCATCATGGTAA
Transcript >OphauB2|4564
ATGGGCGCGATTCTCGGACTGCAAGCAACAGTGCCATGCGAGGTTGGCCAACTGAATCTTGGCGTTCTGGAACAT
CAGCTGCGTCTCTTGTTGGTCAAGAGCGATTCTGTGCGGGTTGAGGAGAGCCAGAGGCTCGAGATTATGGGCTTG
CTGCAAAAAGCCGCGCGGGCACTAGAGGAGCCGTCTGAAACTCTCAAGCGCATCGGGAGCTCTAGCCTACAGCTA
GTCGCTGCAAAGATTGGGCAGGACCACAAGCTCTACGAGACAATAGTCGAGGCCAGCGAGCCGGTTGGCCTTGAG
CAGCTTGAGCATGCCAGTGGGATCAAGGCAGAGACTGTCGACTGTCTCATGGAGTACATATGCACACAAGGTATG
GCGTCACGTAACAGTCGAGGCCAATACGAAGCCACCAAGCTGTCACGCCTCATGATGGAGCCTCTGACGCGGCAT
TGGATGACTCACTTCCATGACTTGATGCTTCCTAGCTATGCAGCACTCAACAAGTCCTTGTTCCAGCCAGATGGC
CCCCTGGCGTTTTGCCTAGCACACGGAACCAAGCAGCCGTTTTACGAGTGGCTGACTTGGCACGAGGCGTACCGA
CGCGCCTTTTACGGAGTCATGGAGGCTTACACACGCCGAGGCTCCTTGTGGCTCGACGTGGTCGACTTTGAAGGC
GAGTTTGGCAGCGGTGACGGGGTTGCCTTTGTCGACGTTGGCGGGGGCATTGGCCAGCAGTGTCAGCATTTGCTG
CAGAGGCATCCTACGCTCAAGGGCCAAGTGGTGCTTCAAGACACGCCAGATGTGCTGAAAGGAGCGTTGCGCGGC
TACGGCATGCAGACAATGAGCTACGACTTTTTCTCGGAGCAGCCAATCAAGGGCGCTCGAGTCTATTACCTGCGG
CAGATTCTACACAACCACTCGGACGAGGACTGTCTTGAAATCCTGCAGGCGCAAAAGGCAGGTCTCGGCGCCAGC
AGCGTGCTTGTCATTGATGAAAAGGTGCTGCCGGATGTGGGGTCGGACGAGGAGGCGTCGGCCGAGTTTGTGGCT
ACCATGGGAATAAACATGCTGGTACTGTTTCGGGCGCAGGAGCGACGAGAATCGCATTGGCGGCGGCTGATGGAG
CAGGCAGGGCTTGGGGTGCGTCAAGTGCGCCGCTATTCGCCGGGGGAAGCCATGATGATTTGTGCATCATGGTAA
Gene >OphauB2|4564
ATGGGCGCGATTCTCGGACTGCAAGCAACAGTGCCATGCGAGGTTGGCCAACTGAATCTTGGCGTTCTGGAACAT
CAGCTGCGTCTCTTGTTGGTCAAGAGCGATTCTGTGCGGGTTGAGGAGAGCCAGAGGCTCGAGATTATGGGCTTG
CTGCAAAAAGCCGCGCGGGCACTAGAGGAGCCGTCTGAAACTCTCAAGCGCATCGGGAGCTCTGTAGGTTCCTTG
GCCATGTGTTCTCTGACTGGCGCCTTGTTTCTTTCCTTGTCGTCATTCATCATGTTGGGCTTGCTGCTTGTTGTG
CAGCAAGAGGCTGATTGACTTGTGGCTGCATAGAGCCTACAGCTAGTCGCTGCAAAGATTGGGCAGGACCACAAG
CTCTACGAGACAATAGTCGAGGCCAGCGAGCCGGTTGGCCTTGAGCAGCTTGAGCATGCCAGTGGGATCAAGGCA
GAGACTGTCGACTGTCTCATGGAGTACATATGCACACAAGGTATGGCGTCACGTAACAGTCGAGGCCAATACGAA
GCCACCAAGCTGTCACGCCTCATGATGGAGCCTCTGACGCGGCATTGGATGACTCACTTGTGGGTTGGCTCAATG
GCTCCCGTTGCCAAGGAATTCAAAGGAGCTAAGAGTGTGATTGAAGCCATGACTTGATGCTTCCTAGCTATGCAG
CACTCAACAAGTCCTTGTTCCAGCCAGATGGCCCCCTGGCGTTTTGCCTAGCACACGGAACCAAGCAGCCGTTTT
ACGAGTGGCTGACTTGGCACGAGGCGTACCGACGCGCCTTTTACGGAGTCATGGAGGCTTACACACGCCGAGGCT
CCTTGTGGCTCGACGTGGTCGACTTTGAAGGCGAGTTTGGCAGCGGTGACGGGGTTGCCTTTGTCGACGTTGGCG
GGGGCATTGGCCAGCAGTGTCAGCATTTGCTGCAGAGGCATCCTACGCTCAAGGGCCAAGTGGTGCTTCAAGACA
CGCCAGATGTGCTGAAAGGAGCGTTGCGCGGCTACGGCATGCAGACAATGAGCTACGACTTTTTCTCGGAGCAGC
CAATCAAGGGTACATTGCCGTTTTGCTTGCATGCCTGCTTCAATGGCTGACGGGTTGCCGACGGGGTGCTGACGG
GACCAATGGCAGGCGCTCGAGTCTATTACCTGCGGCAGATTCTACACAACCACTCGGACGAGGACTGTCTTGAAA
TCCTGCAGGCGCAAAAGGCAGGTCTCGGCGCCAGCAGCGTGCTTGTCATTGATGAAAAGGTGCTGCCGGATGTGG
GGTCGGACGAGGAGGCGTCGGCCGAGTTTGTGGCTACCATGGGAATAAACATGCTGGTACTGTTTCGGGCGCAGG
AGCGACGAGAATCGCATTGGCGGCGGCTGATGGAGCAGGCAGGGCTTGGGGTGCGTCAAGTGCGCCGCTATTCGC
CGGGGGAAGCCATGATGATTTGTGCATCATGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail