Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4549
Gene name
LocationContig_30:76693..78916
Strand-
Gene length (bp)2223
Transcript length (bp)2100
Coding sequence length (bp)2100
Protein length (aa) 700

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11951 Fungal_trans_2 Fungal specific transcription factor domain 6.9E-23 236 509
PF11951 Fungal_trans_2 Fungal specific transcription factor domain 1.1E-10 588 688
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 2.7E-08 159 195

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74308|YOG2_SCHPO Uncharacterized transcriptional regulatory protein C15D4.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.02 PE=3 SV=3 108 191 8.0E-10
sp|Q9UT46|MOC3_SCHPO Transcriptional regulatory protein moc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=moc3 PE=1 SV=4 151 191 2.0E-09
sp|P26370|UGA3_YEAST Transcriptional activator protein UGA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA3 PE=1 SV=1 151 286 4.0E-07
sp|Q9HFR4|ATG2_PICPA Autophagy-related protein 2 OS=Komagataella pastoris GN=ATG2 PE=3 SV=1 157 191 1.0E-06
sp|Q5ANB1|WOR2_CANAL White-opaque regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=WOR2 PE=1 SV=1 160 193 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74308|YOG2_SCHPO Uncharacterized transcriptional regulatory protein C15D4.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.02 PE=3 SV=3 108 191 8.0E-10
sp|Q9UT46|MOC3_SCHPO Transcriptional regulatory protein moc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=moc3 PE=1 SV=4 151 191 2.0E-09
sp|P26370|UGA3_YEAST Transcriptional activator protein UGA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA3 PE=1 SV=1 151 286 4.0E-07
sp|Q9HFR4|ATG2_PICPA Autophagy-related protein 2 OS=Komagataella pastoris GN=ATG2 PE=3 SV=1 157 191 1.0E-06
sp|Q5ANB1|WOR2_CANAL White-opaque regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=WOR2 PE=1 SV=1 160 193 1.0E-06
sp|P0CE41|HAP1_YEAST Heme-responsive zinc finger transcription factor HAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAP1 PE=1 SV=1 113 210 4.0E-06
sp|C7GQY3|HAP1_YEAS2 Heme-responsive zinc finger transcription factor HAP1 OS=Saccharomyces cerevisiae (strain JAY291) GN=HAP1 PE=3 SV=1 113 210 4.0E-06
sp|C8ZDL9|HAP1_YEAS8 Heme-responsive zinc finger transcription factor HAP1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HAP1 PE=3 SV=1 113 210 4.0E-06
sp|A7A1D7|HAP1_YEAS7 Heme-responsive zinc finger transcription factor HAP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=HAP1 PE=3 SV=1 113 210 4.0E-06
sp|B3RHD9|HAP1_YEAS1 Heme-responsive zinc finger transcription factor HAP1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HAP1 PE=3 SV=1 113 210 4.0E-06
sp|P0CS82|HAP1_YEASX Heme-responsive zinc finger transcription factor HAP1 OS=Saccharomyces cerevisiae GN=HAP1 PE=1 SV=1 113 210 4.0E-06
sp|G2WJ80|HAP1_YEASK Heme-responsive zinc finger transcription factor HAP1 OS=Saccharomyces cerevisiae (strain Kyokai no. 7 / NBRC 101557) GN=HAP1 PE=3 SV=2 113 210 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0046914 transition metal ion binding No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0010468 regulation of gene expression No
GO:0140110 transcription regulator activity No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0009889 regulation of biosynthetic process No
GO:0043167 ion binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0003700 DNA-binding transcription factor activity No
GO:0060255 regulation of macromolecule metabolic process No
GO:0050789 regulation of biological process No
GO:0031323 regulation of cellular metabolic process No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0065007 biological regulation No
GO:2001141 regulation of RNA biosynthetic process No
GO:0050794 regulation of cellular process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup891
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1571
Ophiocordyceps australis map64 (Brazil) OphauB2|4549 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03131
Ophiocordyceps camponoti-rufipedis Ophun1|3833
Ophiocordyceps camponoti-rufipedis Ophun1|3834
Ophiocordyceps kimflemingae Ophio5|3076
Ophiocordyceps subramaniannii Hirsu2|5622

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4549
MDPQGGAWGTMVLPSPSPSEPTWNLNSSQAPTQTDQLSPISSALDLPMDPAPSSMALLSATSSCADSWALDDADQ
ERQWDCWDASLDGSFVVPKLEPVDDDDVLLEQVEMAPSSAPPALASSASCKTKQKRPRGRPRKNNLGSCLVPFSA
KVTKGRSKTGCITCRKRKKKCDEAKPRCMNCEKNAVVCEGYHEKQIWKSGRERAEEERLKRETVPVATLPPLING
VETVEDMIFWKHFATSLSNVLTVEGEMGNVFKSIVLPLATKHQGLMHSVLTLSGRHLDYDSPYGAKVLTSNPKTT
RSSLDQRADYHHHEAIKWLQDSIESPTDKHDPGYQTMLAAQYSQILCHLIQTRVDGNTRGEHRIHLRTYQEMMRQ
CPPPVNTMFYAFITEMFQYHIFTDDLFWHPDSRTNRLTSQYWRSDVPLDQPRMIGVDDDLFRLLCHISSMRDKIR
AKLARPYDLLIQYEEIYEGIDIDTAIRDWMPSWPPGDCRHKVMPVYQQTMWIYLYRTLYPPDELLWDGPKHSAYS
TSPQRRASMAATTGYGPATDSTSLDESTSSFSRSCSKTYDASRANSMHELPTSLEPASPLEGRRSSSLQPCSQRL
RIAVEQSLSMLESFKPSDPAQTLLLIPCLINGTACFEVPQRDRIRAAVRTVRGYTGLRSCDRVLQLLEKIWSLMD
QGDEFSVWDWQGLAKRTGLDFGCA*
Coding >OphauB2|4549
ATGGACCCCCAAGGTGGTGCCTGGGGCACCATGGTGCTGCCGTCTCCTTCGCCTTCGGAGCCTACCTGGAACCTC
AACTCGAGCCAGGCGCCCACTCAGACCGATCAACTCTCACCCATTAGCTCCGCCTTGGACCTGCCCATGGACCCT
GCTCCCTCCTCCATGGCCCTGCTCTCGGCCACGTCGTCTTGCGCCGACTCGTGGGCCCTCGACGATGCCGACCAG
GAGCGTCAATGGGACTGCTGGGACGCAAGCCTCGACGGCTCTTTTGTTGTTCCCAAGCTTGAGCCCGTCGACGAC
GACGACGTGCTGCTCGAGCAGGTTGAGATGGCTCCCTCAAGCGCCCCGCCAGCTCTTGCATCCTCGGCTTCTTGC
AAGACGAAGCAAAAGCGGCCGCGTGGACGGCCCCGGAAAAACAACCTGGGGTCGTGTCTCGTCCCCTTTTCTGCA
AAGGTGACCAAGGGCCGCTCCAAGACGGGCTGCATCACTTGTCGCAAGAGAAAGAAGAAGTGCGACGAGGCAAAA
CCGCGATGCATGAATTGTGAAAAGAATGCCGTTGTCTGTGAAGGTTACCACGAGAAGCAAATCTGGAAGAGTGGG
CGGGAGCGGGCTGAGGAAGAGAGGCTCAAGCGAGAGACTGTTCCCGTGGCCACGTTGCCCCCCCTCATCAACGGC
GTGGAAACAGTTGAAGACATGATTTTTTGGAAGCACTTTGCCACGTCTCTAAGCAACGTCCTGACTGTAGAGGGC
GAAATGGGCAACGTCTTCAAGAGCATAGTATTGCCCCTGGCCACCAAGCACCAAGGCCTCATGCACTCGGTGCTC
ACCTTGAGCGGCCGACACCTAGATTATGACTCGCCCTATGGCGCAAAAGTCTTGACTAGCAATCCCAAGACGACG
CGAAGCTCGTTAGACCAACGCGCCGACTACCACCATCATGAGGCCATCAAGTGGCTCCAGGATAGTATTGAGAGT
CCAACTGACAAGCACGATCCCGGCTACCAGACGATGCTGGCGGCACAATATAGCCAGATACTCTGCCACCTCATC
CAGACACGAGTCGACGGCAATACTCGGGGCGAGCATCGCATTCACCTCCGCACTTACCAAGAAATGATGCGCCAG
TGTCCGCCCCCTGTCAACACCATGTTCTATGCCTTCATCACCGAGATGTTTCAATACCACATCTTTACCGACGAC
CTTTTTTGGCATCCAGATTCAAGGACGAATCGGCTGACCTCGCAGTACTGGAGATCAGATGTGCCTCTGGACCAG
CCTCGAATGATTGGTGTCGATGATGATTTGTTTAGGCTGCTCTGTCATATTAGCAGCATGCGCGACAAGATTAGA
GCAAAGCTGGCTCGCCCATATGACCTCTTGATTCAGTACGAGGAAATCTACGAGGGCATCGACATTGACACAGCC
ATACGTGATTGGATGCCATCGTGGCCTCCAGGAGACTGCCGCCACAAGGTAATGCCTGTATATCAGCAAACCATG
TGGATCTACCTCTACCGCACCCTTTACCCACCCGACGAACTCTTGTGGGATGGCCCCAAGCATAGCGCCTACTCG
ACCTCGCCACAGCGACGCGCCTCGATGGCTGCTACGACGGGATATGGGCCCGCGACTGACAGCACCAGCCTTGAC
GAGTCGACGTCTTCCTTTTCGCGAAGCTGCTCCAAAACTTATGATGCATCAAGAGCAAACTCGATGCATGAGCTT
CCCACGAGTCTGGAGCCAGCCTCGCCACTCGAGGGTCGACGCTCCTCTTCGCTTCAACCCTGCTCTCAGCGCCTC
AGGATCGCTGTCGAGCAGTCGTTGTCAATGCTTGAGTCGTTCAAGCCATCGGATCCAGCACAGACGCTGCTGCTG
ATTCCTTGTTTAATCAACGGCACGGCCTGTTTTGAGGTTCCCCAACGCGATCGCATTCGAGCGGCAGTCCGGACT
GTGCGTGGCTATACGGGACTGCGGAGCTGCGACCGCGTCCTACAGCTACTGGAGAAGATTTGGTCTCTGATGGAT
CAGGGCGACGAGTTCTCCGTCTGGGACTGGCAGGGCCTGGCCAAGCGAACAGGTCTCGATTTTGGCTGCGCCTGA
Transcript >OphauB2|4549
ATGGACCCCCAAGGTGGTGCCTGGGGCACCATGGTGCTGCCGTCTCCTTCGCCTTCGGAGCCTACCTGGAACCTC
AACTCGAGCCAGGCGCCCACTCAGACCGATCAACTCTCACCCATTAGCTCCGCCTTGGACCTGCCCATGGACCCT
GCTCCCTCCTCCATGGCCCTGCTCTCGGCCACGTCGTCTTGCGCCGACTCGTGGGCCCTCGACGATGCCGACCAG
GAGCGTCAATGGGACTGCTGGGACGCAAGCCTCGACGGCTCTTTTGTTGTTCCCAAGCTTGAGCCCGTCGACGAC
GACGACGTGCTGCTCGAGCAGGTTGAGATGGCTCCCTCAAGCGCCCCGCCAGCTCTTGCATCCTCGGCTTCTTGC
AAGACGAAGCAAAAGCGGCCGCGTGGACGGCCCCGGAAAAACAACCTGGGGTCGTGTCTCGTCCCCTTTTCTGCA
AAGGTGACCAAGGGCCGCTCCAAGACGGGCTGCATCACTTGTCGCAAGAGAAAGAAGAAGTGCGACGAGGCAAAA
CCGCGATGCATGAATTGTGAAAAGAATGCCGTTGTCTGTGAAGGTTACCACGAGAAGCAAATCTGGAAGAGTGGG
CGGGAGCGGGCTGAGGAAGAGAGGCTCAAGCGAGAGACTGTTCCCGTGGCCACGTTGCCCCCCCTCATCAACGGC
GTGGAAACAGTTGAAGACATGATTTTTTGGAAGCACTTTGCCACGTCTCTAAGCAACGTCCTGACTGTAGAGGGC
GAAATGGGCAACGTCTTCAAGAGCATAGTATTGCCCCTGGCCACCAAGCACCAAGGCCTCATGCACTCGGTGCTC
ACCTTGAGCGGCCGACACCTAGATTATGACTCGCCCTATGGCGCAAAAGTCTTGACTAGCAATCCCAAGACGACG
CGAAGCTCGTTAGACCAACGCGCCGACTACCACCATCATGAGGCCATCAAGTGGCTCCAGGATAGTATTGAGAGT
CCAACTGACAAGCACGATCCCGGCTACCAGACGATGCTGGCGGCACAATATAGCCAGATACTCTGCCACCTCATC
CAGACACGAGTCGACGGCAATACTCGGGGCGAGCATCGCATTCACCTCCGCACTTACCAAGAAATGATGCGCCAG
TGTCCGCCCCCTGTCAACACCATGTTCTATGCCTTCATCACCGAGATGTTTCAATACCACATCTTTACCGACGAC
CTTTTTTGGCATCCAGATTCAAGGACGAATCGGCTGACCTCGCAGTACTGGAGATCAGATGTGCCTCTGGACCAG
CCTCGAATGATTGGTGTCGATGATGATTTGTTTAGGCTGCTCTGTCATATTAGCAGCATGCGCGACAAGATTAGA
GCAAAGCTGGCTCGCCCATATGACCTCTTGATTCAGTACGAGGAAATCTACGAGGGCATCGACATTGACACAGCC
ATACGTGATTGGATGCCATCGTGGCCTCCAGGAGACTGCCGCCACAAGGTAATGCCTGTATATCAGCAAACCATG
TGGATCTACCTCTACCGCACCCTTTACCCACCCGACGAACTCTTGTGGGATGGCCCCAAGCATAGCGCCTACTCG
ACCTCGCCACAGCGACGCGCCTCGATGGCTGCTACGACGGGATATGGGCCCGCGACTGACAGCACCAGCCTTGAC
GAGTCGACGTCTTCCTTTTCGCGAAGCTGCTCCAAAACTTATGATGCATCAAGAGCAAACTCGATGCATGAGCTT
CCCACGAGTCTGGAGCCAGCCTCGCCACTCGAGGGTCGACGCTCCTCTTCGCTTCAACCCTGCTCTCAGCGCCTC
AGGATCGCTGTCGAGCAGTCGTTGTCAATGCTTGAGTCGTTCAAGCCATCGGATCCAGCACAGACGCTGCTGCTG
ATTCCTTGTTTAATCAACGGCACGGCCTGTTTTGAGGTTCCCCAACGCGATCGCATTCGAGCGGCAGTCCGGACT
GTGCGTGGCTATACGGGACTGCGGAGCTGCGACCGCGTCCTACAGCTACTGGAGAAGATTTGGTCTCTGATGGAT
CAGGGCGACGAGTTCTCCGTCTGGGACTGGCAGGGCCTGGCCAAGCGAACAGGTCTCGATTTTGGCTGCGCCTGA
Gene >OphauB2|4549
ATGGACCCCCAAGGTGGTGCCTGGGGCACCATGGTGCTGCCGTCTCCTTCGCCTTCGGAGCCTACCTGGAACCTC
AACTCGAGCCAGGCGCCCACTCAGACCGATCAACTCTCACCCATTAGCTCCGCCTTGGACCTGCCCATGGACCCT
GCTCCCTCCTCCATGGCCCTGCTCTCGGCCACGTCGTCTTGCGCCGACTCGTGGGCCCTCGACGATGCCGACCAG
GAGCGTCAATGGGACTGCTGGGACGCAAGCCTCGACGGCTCTTTTGTTGTTCCCAAGCTTGAGCCCGTCGACGAC
GACGACGTGCTGCTCGAGCAGGTTGAGATGGCTCCCTCAAGCGCCCCGCCAGCTCTTGCATCCTCGGCTTCTTGC
AAGACGAAGCAAAAGCGGCCGCGTGGACGGCCCCGGAAAAACAACCTGGGGTCGTGTCTCGTCCCCTTTTCTGCA
AAGGTGACCAAGGGCCGCTCCAAGACGGGCTGCATCACTTGTCGCAAGAGAAAGAAGAAGTGCGACGAGGCAAAA
CCGCGATGTATGTCTGTCGGCTCGACTACTCCTCGGCTCATGATGCTTGACTGCTGATGCATTCTTGGCCCAGGC
ATGAATTGTGAAAAGAATGCCGTTGTCTGTGAAGGTTACCACGAGAAGCAAATCTGGAAGAGTGGGCGGGAGCGG
GCTGAGGAAGGTAATGAGCAAGACTGTCACGCCAACGCCCAACATGACGGCTGACACAGACCATCAGAGAGGCTC
AAGCGAGAGACTGTTCCCGTGGCCACGTTGCCCCCCCTCATCAACGGCGTGGAAACAGTTGAAGACATGATTTTT
TGGAAGCACTTTGCCACGTCTCTAAGCAACGTCCTGACTGTAGAGGGCGAAATGGGCAACGTCTTCAAGAGCATA
GTATTGCCCCTGGCCACCAAGCACCAAGGCCTCATGCACTCGGTGCTCACCTTGAGCGGCCGACACCTAGATTAT
GACTCGCCCTATGGCGCAAAAGTCTTGACTAGCAATCCCAAGACGACGCGAAGCTCGTTAGACCAACGCGCCGAC
TACCACCATCATGAGGCCATCAAGTGGCTCCAGGATAGTATTGAGAGTCCAACTGACAAGCACGATCCCGGCTAC
CAGACGATGCTGGCGGCACAATATAGCCAGATACTCTGCCACCTCATCCAGACACGAGTCGACGGCAATACTCGG
GGCGAGCATCGCATTCACCTCCGCACTTACCAAGAAATGATGCGCCAGTGTCCGCCCCCTGTCAACACCATGTTC
TATGCCTTCATCACCGAGATGTTTCAATACCACATCTTTACCGACGACCTTTTTTGGCATCCAGATTCAAGGACG
AATCGGCTGACCTCGCAGTACTGGAGATCAGATGTGCCTCTGGACCAGCCTCGAATGATTGGTGTCGATGATGAT
TTGTTTAGGCTGCTCTGTCATATTAGCAGCATGCGCGACAAGATTAGAGCAAAGCTGGCTCGCCCATATGACCTC
TTGATTCAGTACGAGGAAATCTACGAGGGCATCGACATTGACACAGCCATACGTGATTGGATGCCATCGTGGCCT
CCAGGAGACTGCCGCCACAAGGTAATGCCTGTATATCAGCAAACCATGTGGATCTACCTCTACCGCACCCTTTAC
CCACCCGACGAACTCTTGTGGGATGGCCCCAAGCATAGCGCCTACTCGACCTCGCCACAGCGACGCGCCTCGATG
GCTGCTACGACGGGATATGGGCCCGCGACTGACAGCACCAGCCTTGACGAGTCGACGTCTTCCTTTTCGCGAAGC
TGCTCCAAAACTTATGATGCATCAAGAGCAAACTCGATGCATGAGCTTCCCACGAGTCTGGAGCCAGCCTCGCCA
CTCGAGGGTCGACGCTCCTCTTCGCTTCAACCCTGCTCTCAGCGCCTCAGGATCGCTGTCGAGCAGTCGTTGTCA
ATGCTTGAGTCGTTCAAGCCATCGGATCCAGCACAGACGCTGCTGCTGATTCCTTGTTTAATCAACGGCACGGCC
TGTTTTGAGGTTCCCCAACGCGATCGCATTCGAGCGGCAGTCCGGACTGTGCGTGGCTATACGGGACTGCGGAGC
TGCGACCGCGTCCTACAGCTACTGGAGAAGATTTGGTCTCTGATGGATCAGGGCGACGAGTTCTCCGTCTGGGAC
TGGCAGGGCCTGGCCAAGCGAACAGGTCTCGATTTTGGCTGCGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail