Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4535
Gene name
LocationContig_30:41683..45227
Strand+
Gene length (bp)3544
Transcript length (bp)3462
Coding sequence length (bp)3462
Protein length (aa) 1154

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00439 Bromodomain Bromodomain 6.0E-19 328 404
PF07524 Bromo_TP Bromodomain associated 1.6E-09 784 837

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87152|SPT7_SCHPO Transcriptional activator spt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt7 PE=1 SV=2 217 439 6.0E-52
sp|P35177|SPT7_YEAST Transcriptional activator SPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT7 PE=1 SV=1 167 473 8.0E-52
sp|P87152|SPT7_SCHPO Transcriptional activator spt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt7 PE=1 SV=2 722 1051 6.0E-46
sp|P35177|SPT7_YEAST Transcriptional activator SPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT7 PE=1 SV=1 572 1053 1.0E-30
sp|Q54UW4|Y0777_DICDI Bromodomain-containing protein DDB_G0280777 OS=Dictyostelium discoideum GN=DDB_G0280777 PE=3 SV=1 299 428 7.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87152|SPT7_SCHPO Transcriptional activator spt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt7 PE=1 SV=2 217 439 6.0E-52
sp|P35177|SPT7_YEAST Transcriptional activator SPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT7 PE=1 SV=1 167 473 8.0E-52
sp|P87152|SPT7_SCHPO Transcriptional activator spt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt7 PE=1 SV=2 722 1051 6.0E-46
sp|P35177|SPT7_YEAST Transcriptional activator SPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT7 PE=1 SV=1 572 1053 1.0E-30
sp|Q54UW4|Y0777_DICDI Bromodomain-containing protein DDB_G0280777 OS=Dictyostelium discoideum GN=DDB_G0280777 PE=3 SV=1 299 428 7.0E-21
sp|Q03330|GCN5_YEAST Histone acetyltransferase GCN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN5 PE=1 SV=1 327 427 4.0E-15
sp|Q12830|BPTF_HUMAN Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens GN=BPTF PE=1 SV=3 322 400 4.0E-14
sp|Q756G9|GCN5_ASHGO Histone acetyltransferase GCN5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GCN5 PE=3 SV=1 325 416 6.0E-14
sp|Q6CXW4|GCN5_KLULA Histone acetyltransferase GCN5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GCN5 PE=3 SV=1 325 427 6.0E-14
sp|Q6FTW5|GCN5_CANGA Histone acetyltransferase GCN5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GCN5 PE=3 SV=1 325 427 1.0E-13
sp|Q9BXF3|CECR2_HUMAN Cat eye syndrome critical region protein 2 OS=Homo sapiens GN=CECR2 PE=1 SV=2 325 400 4.0E-12
sp|Q9UUK2|GCN5_SCHPO Histone acetyltransferase gcn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn5 PE=1 SV=1 324 420 7.0E-12
sp|Q9Y7N0|BDF1_SCHPO SWR1 complex bromodomain subunit bdf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bdf1 PE=1 SV=1 331 427 2.0E-11
sp|Q8WZM0|GCN5_YARLI Histone acetyltransferase GCN5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GCN5 PE=3 SV=1 325 402 2.0E-11
sp|Q9HGP4|YK82_SCHPO Bromodomain-containing protein C631.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC631.02 PE=1 SV=3 295 428 3.0E-11
sp|Q9JHD2|KAT2A_MOUSE Histone acetyltransferase KAT2A OS=Mus musculus GN=Kat2a PE=1 SV=2 322 400 3.0E-11
sp|Q92830|KAT2A_HUMAN Histone acetyltransferase KAT2A OS=Homo sapiens GN=KAT2A PE=1 SV=3 322 400 4.0E-11
sp|Q9JHD1|KAT2B_MOUSE Histone acetyltransferase KAT2B OS=Mus musculus GN=Kat2b PE=1 SV=2 315 400 5.0E-11
sp|Q92831|KAT2B_HUMAN Histone acetyltransferase KAT2B OS=Homo sapiens GN=KAT2B PE=1 SV=3 315 400 5.0E-11
sp|P35817|BDF1_YEAST Bromodomain-containing factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BDF1 PE=1 SV=3 328 412 7.0E-11
sp|P13709|FSH_DROME Homeotic protein female sterile OS=Drosophila melanogaster GN=fs(1)h PE=1 SV=2 320 400 8.0E-11
sp|Q8UVR5|BAZ1A_XENLA Bromodomain adjacent to zinc finger domain protein 1A (Fragment) OS=Xenopus laevis GN=baz1a PE=2 SV=1 314 401 2.0E-10
sp|Q9W0T1|NU301_DROME Nucleosome-remodeling factor subunit NURF301 OS=Drosophila melanogaster GN=E(bx) PE=1 SV=2 307 400 4.0E-10
sp|F1R5H6|BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio GN=brd4 PE=1 SV=1 323 401 4.0E-10
sp|Q9HGP4|YK82_SCHPO Bromodomain-containing protein C631.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC631.02 PE=1 SV=3 342 432 5.0E-10
sp|Q9UIF8|BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens GN=BAZ2B PE=1 SV=3 331 420 5.0E-10
sp|O88379|BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus GN=Baz1a PE=1 SV=3 327 400 1.0E-09
sp|Q9NRL2|BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens GN=BAZ1A PE=1 SV=2 327 400 1.0E-09
sp|Q6BGW1|GCN5_DEBHA Histone acetyltransferase GCN5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GCN5 PE=3 SV=2 325 402 2.0E-09
sp|Q54DH8|TAF1_DICDI Transcription initiation factor TFIID subunit 1 OS=Dictyostelium discoideum GN=taf1 PE=3 SV=1 323 401 2.0E-09
sp|Q9DE13|BAZ2B_CHICK Bromodomain adjacent to zinc finger domain protein 2B OS=Gallus gallus GN=BAZ2B PE=2 SV=1 331 420 3.0E-09
sp|Q58F21|BRDT_HUMAN Bromodomain testis-specific protein OS=Homo sapiens GN=BRDT PE=1 SV=4 331 460 3.0E-09
sp|P51123|TAF1_DROME Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster GN=Taf1 PE=1 SV=3 320 400 4.0E-09
sp|Q9ULD4|BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens GN=BRPF3 PE=1 SV=2 286 400 4.0E-09
sp|Q07442|BDF2_YEAST Bromodomain-containing factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BDF2 PE=1 SV=1 325 404 5.0E-09
sp|B7ZS37|BAZ2A_XENLA Bromodomain adjacent to zinc finger domain protein 2A OS=Xenopus laevis GN=baz2a PE=2 SV=1 328 402 6.0E-09
sp|P21675|TAF1_HUMAN Transcription initiation factor TFIID subunit 1 OS=Homo sapiens GN=TAF1 PE=1 SV=2 328 400 7.0E-09
sp|Q6DFF2|BRD4B_XENLA Bromodomain-containing protein 4B OS=Xenopus laevis GN=brd4-b PE=2 SV=1 323 401 1.0E-08
sp|Q9H0E9|BRD8_HUMAN Bromodomain-containing protein 8 OS=Homo sapiens GN=BRD8 PE=1 SV=2 341 418 1.0E-08
sp|Q9UIF9|BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens GN=BAZ2A PE=1 SV=4 328 410 1.0E-08
sp|Q84XV2|GTE1_ARATH Transcription factor GTE1 OS=Arabidopsis thaliana GN=GTE1 PE=2 SV=1 318 445 1.0E-08
sp|Q91YE5|BAZ2A_MOUSE Bromodomain adjacent to zinc finger domain protein 2A OS=Mus musculus GN=Baz2a PE=1 SV=2 328 410 1.0E-08
sp|D4A7T3|BRDT_RAT Bromodomain testis-specific protein OS=Rattus norvegicus GN=Brdt PE=1 SV=1 331 432 2.0E-08
sp|Q4R8Y1|BRDT_MACFA Bromodomain testis-specific protein OS=Macaca fascicularis GN=BRDT PE=2 SV=3 331 460 2.0E-08
sp|Q8IZX4|TAF1L_HUMAN Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens GN=TAF1L PE=1 SV=1 328 400 2.0E-08
sp|F7DRV9|BRDT_XENTR Bromodomain testis-specific protein OS=Xenopus tropicalis GN=brdt PE=3 SV=1 326 401 2.0E-08
sp|O95696|BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens GN=BRD1 PE=1 SV=1 270 400 2.0E-08
sp|Q6DFF2|BRD4B_XENLA Bromodomain-containing protein 4B OS=Xenopus laevis GN=brd4-b PE=2 SV=1 336 400 3.0E-08
sp|Q80UV9|TAF1_MOUSE Transcription initiation factor TFIID subunit 1 OS=Mus musculus GN=Taf1 PE=1 SV=2 328 400 3.0E-08
sp|Q60544|TAF1_MESAU Transcription initiation factor TFIID subunit 1 OS=Mesocricetus auratus GN=TAF1 PE=2 SV=1 328 400 3.0E-08
sp|Q6E2N3|TRI33_DANRE E3 ubiquitin-protein ligase TRIM33 OS=Danio rerio GN=trim33 PE=2 SV=1 310 401 4.0E-08
sp|Q67W65|TAF1_ORYSJ Transcription initiation factor TFIID subunit 1 OS=Oryza sativa subsp. japonica GN=TAF1 PE=2 SV=1 323 406 5.0E-08
sp|P13709|FSH_DROME Homeotic protein female sterile OS=Drosophila melanogaster GN=fs(1)h PE=1 SV=2 320 401 6.0E-08
sp|Q91Y44|BRDT_MOUSE Bromodomain testis-specific protein OS=Mus musculus GN=Brdt PE=1 SV=3 331 432 6.0E-08
sp|Q15059|BRD3_HUMAN Bromodomain-containing protein 3 OS=Homo sapiens GN=BRD3 PE=1 SV=1 331 401 6.0E-08
sp|Q93YS6|GTE9_ARATH Transcription factor GTE9 OS=Arabidopsis thaliana GN=GTE9 PE=1 SV=1 324 416 6.0E-08
sp|Q9ESU6|BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus GN=Brd4 PE=1 SV=2 323 401 6.0E-08
sp|Q08D75|BRD4A_XENLA Bromodomain-containing protein 4A OS=Xenopus laevis GN=brd4-a PE=2 SV=1 323 401 6.0E-08
sp|O60885|BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens GN=BRD4 PE=1 SV=2 323 401 6.0E-08
sp|Q58F21|BRDT_HUMAN Bromodomain testis-specific protein OS=Homo sapiens GN=BRDT PE=1 SV=4 331 401 7.0E-08
sp|Q9FGW9|GTE10_ARATH Transcription factor GTE10 OS=Arabidopsis thaliana GN=GTE10 PE=1 SV=2 324 416 7.0E-08
sp|Q5A4W8|BDF1_CANAL Bromodomain-containing factor 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BDF1 PE=2 SV=1 331 426 8.0E-08
sp|Q8K2F0|BRD3_MOUSE Bromodomain-containing protein 3 OS=Mus musculus GN=Brd3 PE=1 SV=2 331 401 8.0E-08
sp|Q4R8Y1|BRDT_MACFA Bromodomain testis-specific protein OS=Macaca fascicularis GN=BRDT PE=2 SV=3 331 401 1.0E-07
sp|Q9AR19|GCN5_ARATH Histone acetyltransferase GCN5 OS=Arabidopsis thaliana GN=HAG1 PE=1 SV=1 320 400 1.0E-07
sp|A2BIL7|BAZ1B_DANRE Tyrosine-protein kinase BAZ1B OS=Danio rerio GN=baz1b PE=1 SV=2 326 425 1.0E-07
sp|F1R5H6|BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio GN=brd4 PE=1 SV=1 288 400 2.0E-07
sp|Q08D75|BRD4A_XENLA Bromodomain-containing protein 4A OS=Xenopus laevis GN=brd4-a PE=2 SV=1 336 400 2.0E-07
sp|Q8K2F0|BRD3_MOUSE Bromodomain-containing protein 3 OS=Mus musculus GN=Brd3 PE=1 SV=2 331 427 2.0E-07
sp|Q338B9|GCN5_ORYSJ Histone acetyltransferase GCN5 OS=Oryza sativa subsp. japonica GN=GCN5 PE=2 SV=1 308 400 2.0E-07
sp|Q9Z277|BAZ1B_MOUSE Tyrosine-protein kinase BAZ1B OS=Mus musculus GN=Baz1b PE=1 SV=2 326 467 2.0E-07
sp|F1QW93|BRDT_DANRE Bromodomain testis-specific protein OS=Danio rerio GN=brdt PE=3 SV=2 326 401 2.0E-07
sp|Q93ZB7|GTE11_ARATH Transcription factor GTE11 OS=Arabidopsis thaliana GN=GTE11 PE=1 SV=1 326 416 2.0E-07
sp|Q8LRK9|TAF1_ARATH Transcription initiation factor TFIID subunit 1 OS=Arabidopsis thaliana GN=TAF1 PE=1 SV=1 324 404 2.0E-07
sp|Q5TJG6|BRD2_CANLF Bromodomain-containing protein 2 OS=Canis lupus familiaris GN=BRD2 PE=3 SV=1 331 400 2.0E-07
sp|Q6MGA9|BRD2_RAT Bromodomain-containing protein 2 OS=Rattus norvegicus GN=Brd2 PE=1 SV=1 331 400 2.0E-07
sp|Q32S26|BRD2_BOVIN Bromodomain-containing protein 2 OS=Bos taurus GN=BRD2 PE=3 SV=1 331 400 2.0E-07
sp|Q7JJ13|BRD2_MOUSE Bromodomain-containing protein 2 OS=Mus musculus GN=Brd2 PE=1 SV=1 331 400 2.0E-07
sp|P25440|BRD2_HUMAN Bromodomain-containing protein 2 OS=Homo sapiens GN=BRD2 PE=1 SV=2 331 400 2.0E-07
sp|G5EGM3|TAF1_CAEEL Transcription initiation factor TFIID subunit 1 OS=Caenorhabditis elegans GN=taf-1 PE=2 SV=1 328 404 2.0E-07
sp|P51123|TAF1_DROME Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster GN=Taf1 PE=1 SV=3 324 400 3.0E-07
sp|Q92793|CBP_HUMAN CREB-binding protein OS=Homo sapiens GN=CREBBP PE=1 SV=3 322 401 3.0E-07
sp|Q5A4W8|BDF1_CANAL Bromodomain-containing factor 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BDF1 PE=2 SV=1 336 423 4.0E-07
sp|Q6JHU9|CBP_RAT CREB-binding protein OS=Rattus norvegicus GN=Crebbp PE=1 SV=1 322 401 4.0E-07
sp|Q9H8M2|BRD9_HUMAN Bromodomain-containing protein 9 OS=Homo sapiens GN=BRD9 PE=1 SV=2 306 401 4.0E-07
sp|P45481|CBP_MOUSE CREB-binding protein OS=Mus musculus GN=Crebbp PE=1 SV=3 322 401 4.0E-07
sp|Q3UQU0|BRD9_MOUSE Bromodomain-containing protein 9 OS=Mus musculus GN=Brd9 PE=1 SV=1 306 401 4.0E-07
sp|Q91Y44|BRDT_MOUSE Bromodomain testis-specific protein OS=Mus musculus GN=Brdt PE=1 SV=3 331 401 5.0E-07
sp|Q56R14|TRI33_XENLA E3 ubiquitin-protein ligase TRIM33 OS=Xenopus laevis GN=trim33 PE=1 SV=1 328 403 5.0E-07
sp|Q8R3B7|BRD8_MOUSE Bromodomain-containing protein 8 OS=Mus musculus GN=Brd8 PE=1 SV=2 316 478 5.0E-07
sp|Q9Y7N0|BDF1_SCHPO SWR1 complex bromodomain subunit bdf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bdf1 PE=1 SV=1 331 400 6.0E-07
sp|Q64127|TIF1A_MOUSE Transcription intermediary factor 1-alpha OS=Mus musculus GN=Trim24 PE=1 SV=1 328 401 6.0E-07
sp|Q15059|BRD3_HUMAN Bromodomain-containing protein 3 OS=Homo sapiens GN=BRD3 PE=1 SV=1 331 427 7.0E-07
sp|O15164|TIF1A_HUMAN Transcription intermediary factor 1-alpha OS=Homo sapiens GN=TRIM24 PE=1 SV=3 328 401 9.0E-07
sp|Q9ESU6|BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus GN=Brd4 PE=1 SV=2 331 400 1.0E-06
sp|O60885|BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens GN=BRD4 PE=1 SV=2 288 400 1.0E-06
sp|P55201|BRPF1_HUMAN Peregrin OS=Homo sapiens GN=BRPF1 PE=1 SV=2 353 400 1.0E-06
sp|Q6BER5|NU301_CAEEL Nucleosome-remodeling factor subunit NURF301-like OS=Caenorhabditis elegans GN=nurf-1 PE=1 SV=2 342 404 1.0E-06
sp|F7DRV9|BRDT_XENTR Bromodomain testis-specific protein OS=Xenopus tropicalis GN=brdt PE=3 SV=1 331 427 2.0E-06
sp|Q6NVM8|BRD9_XENTR Bromodomain-containing protein 9 OS=Xenopus tropicalis GN=brd9 PE=2 SV=1 306 401 2.0E-06
sp|Q9UIG0|BAZ1B_HUMAN Tyrosine-protein kinase BAZ1B OS=Homo sapiens GN=BAZ1B PE=1 SV=2 341 467 2.0E-06
sp|Q9S7T1|GTE3_ARATH Transcription factor GTE3, chloroplastic OS=Arabidopsis thaliana GN=GTE3 PE=1 SV=1 323 424 4.0E-06
sp|F1QW93|BRDT_DANRE Bromodomain testis-specific protein OS=Danio rerio GN=brdt PE=3 SV=2 331 427 5.0E-06
sp|Q9H0E9|BRD8_HUMAN Bromodomain-containing protein 8 OS=Homo sapiens GN=BRD8 PE=1 SV=2 316 418 7.0E-06
sp|P35817|BDF1_YEAST Bromodomain-containing factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BDF1 PE=1 SV=3 344 426 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Bromodomain transcription factor

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4535
MSFSNGQHAWPPPVLHHASASRSVIHLDDGFARNQTPVDNSMTSMPEAPVDIEDESCRALFADLYRRTEDKVALL
FASDGSYNRAAIAALKRASPTPAVSLPPTTDHEPIQEPPRKKARRTIDEYDYDDDDGDDEEDTQTAAAPAKPTSN
TAVAAAGSLLSPSKSGSSPVHSVNSPGRQIDKYKSVESSQGKDKAGDDSIKSLQEARMATEDAARRSFHTVFYTL
ENDRTAMLEQQRLEDSEKQLQAEMDHNSSSNAVQTANQGSLSSANLGASSLTLKHLIARIDLKRDQVRASDAELR
LLMNEVRKNRSKWASEEHINQEELYEALEKVLTELKAHTEYSTPFLTRVNKRDAPDYYNFIKNPMDLGTMTKKLK
SFTYKSKTDFVTDLNLIWDNCLKYNQDMNHPLRRMANGMRKEAEKLVPLIPDLVVRSRTDIEAEERRKQNGGDDD
NGDDSDDEPIMSSRGRKAATKGANKSRKAPSDHKEETPVIDQKPVLQLNGLLGKAGRESSEAVDGSNGFATPPIG
GSMTPSGNVNSHSALTSNVDAMDIDGPSLNGMTLNQAFGEAVEQPYEDEEYKIWKQMTKKDRALAAKERHMLFKE
NSLNVEASALLRSKTDMGRQLKHQQEAEALGLASYPYLGTGSSTGQDSGSKTAETLVGGMDEEAEKVLPDYYETL
SHMPDIPANLQWVEDGEGQVINQHEQFLRLVSPGFFTAPRSRLTKKMDDNIRQIQETRKLATKISIVKQMQVQTQ
VYSNQFPKSNTEPFVEQDIDSHFISDSGPVIAPETCQDALKRSIAKILYHQGFEELQPSAIDAFTGIAADYFQKV
CRTLSIYCEAEKVPVQTPEGFELRSRFTPEEVVLHTLDENGFDVGSLDSYAKDDMDRLGSKLGALHERMKLHLTD
LLRPALSADAGADGVGAFNDGSEQFMSGDFAEDLGEDFFGFRALGLDKEMGIDSISVPFHFLHSRVRNQYQMQTQ
VSGGSTSSLVEALAPPDAVNKENIQDQIGLVKNFFLAKLHANTDQALVEDEDLPVKQRKPRPRLGATGKIISAQK
RPPREQLALAKKRKKMELAAAAAAEAKASQGAPADKGAAAPNAASSTLPSKRKASNITADANPPAAAPSNAMERT
ASMQSQGANSQTDKEDTTGMMSPDSIAQ*
Coding >OphauB2|4535
ATGTCGTTTTCAAATGGCCAGCACGCCTGGCCACCACCCGTCCTACACCATGCTTCGGCCAGTCGGTCTGTCATT
CATCTTGATGATGGTTTCGCCCGCAACCAGACCCCGGTCGACAATTCCATGACTTCGATGCCCGAAGCACCCGTC
GACATCGAAGATGAAAGTTGTCGCGCTCTATTTGCCGATCTTTATCGAAGGACCGAAGATAAGGTGGCGCTTTTG
TTTGCCAGTGATGGTTCCTACAACCGTGCTGCCATTGCTGCTCTGAAGCGAGCTTCGCCAACTCCAGCCGTGTCG
TTGCCCCCAACTACCGACCACGAACCAATTCAAGAGCCACCGCGGAAAAAAGCACGGCGCACCATTGATGAGTAC
GACTACGACGATGACGATGGCGACGACGAAGAAGATACGCAAACAGCTGCTGCCCCCGCGAAGCCGACGAGCAAC
ACGGCTGTTGCCGCTGCTGGCTCCCTTCTCTCGCCATCTAAATCGGGTAGCTCTCCGGTACACTCGGTCAACTCG
CCTGGTAGGCAGATAGACAAGTACAAGTCTGTCGAGTCGTCGCAAGGAAAAGACAAGGCCGGTGATGACTCCATC
AAGTCCCTCCAGGAAGCTCGAATGGCCACCGAAGATGCTGCTCGCCGAAGCTTCCACACCGTATTTTATACTCTA
GAAAATGACCGAACGGCAATGCTTGAGCAGCAAAGACTTGAAGATTCTGAAAAACAGCTTCAGGCAGAAATGGAT
CACAACAGCTCGTCAAACGCCGTCCAGACTGCCAATCAAGGATCCTTGAGTAGCGCCAATCTTGGCGCCTCTAGC
CTGACATTAAAGCACCTCATCGCTAGGATTGACTTGAAACGAGATCAGGTTCGCGCTTCTGATGCAGAACTACGT
CTTCTTATGAATGAAGTACGCAAGAATCGAAGTAAATGGGCCAGCGAAGAACACATTAATCAGGAAGAACTGTAC
GAGGCTCTGGAAAAGGTTCTCACTGAACTCAAAGCACATACAGAGTACTCGACGCCTTTTCTTACTCGGGTTAAT
AAAAGAGATGCTCCTGACTATTACAACTTCATCAAGAATCCCATGGACTTGGGCACAATGACGAAGAAGCTCAAG
TCTTTTACATACAAGTCAAAGACGGATTTTGTTACCGATTTGAACCTCATATGGGATAATTGCCTCAAATACAAT
CAGGACATGAACCACCCTCTTCGACGCATGGCCAATGGCATGAGAAAAGAGGCAGAAAAACTGGTGCCCCTAATT
CCTGATCTTGTGGTGCGCTCTCGAACCGATATTGAGGCCGAGGAGCGGCGCAAGCAAAACGGCGGCGATGACGAT
AATGGCGACGATTCGGATGATGAACCAATCATGTCATCGCGCGGACGGAAAGCAGCCACAAAAGGCGCCAATAAG
TCTCGGAAAGCCCCAAGCGATCATAAGGAAGAGACACCTGTGATAGACCAGAAGCCAGTCTTGCAGCTCAACGGC
CTTTTGGGTAAGGCGGGCAGAGAGAGTTCTGAGGCGGTGGATGGAAGCAATGGCTTCGCAACACCTCCTATTGGC
GGCTCAATGACTCCCAGCGGAAACGTCAACAGCCACTCGGCCTTGACCAGCAACGTAGACGCCATGGACATTGAC
GGGCCCAGCCTCAACGGCATGACTTTGAACCAGGCATTTGGAGAGGCTGTGGAGCAGCCGTATGAAGACGAGGAG
TACAAGATTTGGAAGCAAATGACCAAGAAGGACAGGGCGTTGGCTGCCAAGGAACGCCACATGCTCTTCAAGGAG
AACAGCCTCAACGTGGAAGCTTCAGCACTGCTCAGGAGCAAGACGGACATGGGGCGGCAGCTGAAGCATCAGCAG
GAGGCGGAAGCACTTGGTCTTGCTTCGTACCCGTACCTGGGCACCGGTTCAAGCACAGGACAAGACTCAGGCAGC
AAGACTGCAGAGACGCTGGTGGGCGGGATGGACGAAGAGGCAGAAAAGGTGCTGCCCGACTACTACGAGACGCTA
AGCCACATGCCTGACATTCCTGCAAATCTTCAGTGGGTGGAAGATGGCGAGGGCCAGGTCATCAACCAGCACGAG
CAGTTTCTGCGCCTCGTATCTCCCGGCTTCTTTACAGCGCCTCGCAGTCGGCTGACCAAGAAGATGGACGACAAC
ATCCGCCAGATTCAGGAGACGAGGAAACTTGCCACCAAGATCTCCATTGTCAAGCAGATGCAGGTGCAGACGCAG
GTCTACTCGAACCAGTTCCCCAAGTCCAACACGGAGCCGTTTGTGGAACAAGACATTGATTCGCATTTCATCTCG
GACAGCGGACCCGTCATAGCCCCAGAGACGTGTCAGGACGCACTCAAGCGCTCCATCGCCAAGATCCTGTACCAC
CAGGGATTCGAAGAGCTGCAGCCGTCAGCCATTGACGCCTTTACCGGCATTGCGGCCGACTACTTCCAAAAGGTA
TGCCGAACGCTGAGCATATACTGCGAGGCTGAAAAGGTGCCGGTGCAGACGCCCGAGGGATTCGAGCTGCGGTCT
CGCTTCACTCCAGAAGAGGTGGTGCTTCACACGCTGGATGAAAACGGCTTCGACGTTGGCTCGCTCGACTCGTAT
GCCAAGGACGACATGGATCGGCTGGGCAGCAAGCTGGGGGCTCTTCACGAGAGAATGAAGCTGCACCTGACGGAT
CTGCTTCGGCCCGCCTTGTCGGCGGACGCGGGCGCTGACGGGGTTGGGGCCTTTAACGACGGCAGTGAGCAATTC
ATGAGCGGCGACTTTGCCGAAGACCTGGGCGAAGACTTCTTTGGCTTCCGGGCCCTGGGTCTGGACAAGGAAATG
GGCATTGACTCGATATCCGTGCCCTTCCACTTTTTGCACAGCAGGGTGCGCAACCAGTATCAGATGCAGACCCAA
GTCAGCGGCGGATCCACGTCAAGCCTGGTGGAAGCCCTGGCGCCGCCAGACGCGGTCAACAAGGAGAACATCCAG
GACCAGATTGGCCTGGTCAAGAACTTCTTTCTGGCCAAGCTGCATGCCAACACGGATCAGGCCCTGGTTGAGGAC
GAAGACCTGCCCGTCAAGCAGCGCAAGCCACGGCCCCGCCTCGGCGCCACGGGCAAAATCATATCCGCCCAGAAG
CGTCCGCCCAGGGAGCAGCTGGCGCTGGCCAAGAAGAGGAAGAAGATGGAGCTTGCCGCCGCCGCTGCTGCCGAG
GCCAAGGCCAGCCAGGGCGCCCCGGCTGACAAGGGCGCGGCGGCCCCCAATGCCGCCAGCAGCACCCTTCCGTCC
AAGAGGAAGGCTTCCAACATTACTGCTGATGCCAACCCTCCTGCTGCTGCGCCCTCCAATGCCATGGAACGCACC
GCCAGCATGCAGAGCCAGGGCGCCAACAGCCAGACTGACAAGGAGGACACGACGGGCATGATGAGTCCGGACAGC
ATTGCTCAGTAG
Transcript >OphauB2|4535
ATGTCGTTTTCAAATGGCCAGCACGCCTGGCCACCACCCGTCCTACACCATGCTTCGGCCAGTCGGTCTGTCATT
CATCTTGATGATGGTTTCGCCCGCAACCAGACCCCGGTCGACAATTCCATGACTTCGATGCCCGAAGCACCCGTC
GACATCGAAGATGAAAGTTGTCGCGCTCTATTTGCCGATCTTTATCGAAGGACCGAAGATAAGGTGGCGCTTTTG
TTTGCCAGTGATGGTTCCTACAACCGTGCTGCCATTGCTGCTCTGAAGCGAGCTTCGCCAACTCCAGCCGTGTCG
TTGCCCCCAACTACCGACCACGAACCAATTCAAGAGCCACCGCGGAAAAAAGCACGGCGCACCATTGATGAGTAC
GACTACGACGATGACGATGGCGACGACGAAGAAGATACGCAAACAGCTGCTGCCCCCGCGAAGCCGACGAGCAAC
ACGGCTGTTGCCGCTGCTGGCTCCCTTCTCTCGCCATCTAAATCGGGTAGCTCTCCGGTACACTCGGTCAACTCG
CCTGGTAGGCAGATAGACAAGTACAAGTCTGTCGAGTCGTCGCAAGGAAAAGACAAGGCCGGTGATGACTCCATC
AAGTCCCTCCAGGAAGCTCGAATGGCCACCGAAGATGCTGCTCGCCGAAGCTTCCACACCGTATTTTATACTCTA
GAAAATGACCGAACGGCAATGCTTGAGCAGCAAAGACTTGAAGATTCTGAAAAACAGCTTCAGGCAGAAATGGAT
CACAACAGCTCGTCAAACGCCGTCCAGACTGCCAATCAAGGATCCTTGAGTAGCGCCAATCTTGGCGCCTCTAGC
CTGACATTAAAGCACCTCATCGCTAGGATTGACTTGAAACGAGATCAGGTTCGCGCTTCTGATGCAGAACTACGT
CTTCTTATGAATGAAGTACGCAAGAATCGAAGTAAATGGGCCAGCGAAGAACACATTAATCAGGAAGAACTGTAC
GAGGCTCTGGAAAAGGTTCTCACTGAACTCAAAGCACATACAGAGTACTCGACGCCTTTTCTTACTCGGGTTAAT
AAAAGAGATGCTCCTGACTATTACAACTTCATCAAGAATCCCATGGACTTGGGCACAATGACGAAGAAGCTCAAG
TCTTTTACATACAAGTCAAAGACGGATTTTGTTACCGATTTGAACCTCATATGGGATAATTGCCTCAAATACAAT
CAGGACATGAACCACCCTCTTCGACGCATGGCCAATGGCATGAGAAAAGAGGCAGAAAAACTGGTGCCCCTAATT
CCTGATCTTGTGGTGCGCTCTCGAACCGATATTGAGGCCGAGGAGCGGCGCAAGCAAAACGGCGGCGATGACGAT
AATGGCGACGATTCGGATGATGAACCAATCATGTCATCGCGCGGACGGAAAGCAGCCACAAAAGGCGCCAATAAG
TCTCGGAAAGCCCCAAGCGATCATAAGGAAGAGACACCTGTGATAGACCAGAAGCCAGTCTTGCAGCTCAACGGC
CTTTTGGGTAAGGCGGGCAGAGAGAGTTCTGAGGCGGTGGATGGAAGCAATGGCTTCGCAACACCTCCTATTGGC
GGCTCAATGACTCCCAGCGGAAACGTCAACAGCCACTCGGCCTTGACCAGCAACGTAGACGCCATGGACATTGAC
GGGCCCAGCCTCAACGGCATGACTTTGAACCAGGCATTTGGAGAGGCTGTGGAGCAGCCGTATGAAGACGAGGAG
TACAAGATTTGGAAGCAAATGACCAAGAAGGACAGGGCGTTGGCTGCCAAGGAACGCCACATGCTCTTCAAGGAG
AACAGCCTCAACGTGGAAGCTTCAGCACTGCTCAGGAGCAAGACGGACATGGGGCGGCAGCTGAAGCATCAGCAG
GAGGCGGAAGCACTTGGTCTTGCTTCGTACCCGTACCTGGGCACCGGTTCAAGCACAGGACAAGACTCAGGCAGC
AAGACTGCAGAGACGCTGGTGGGCGGGATGGACGAAGAGGCAGAAAAGGTGCTGCCCGACTACTACGAGACGCTA
AGCCACATGCCTGACATTCCTGCAAATCTTCAGTGGGTGGAAGATGGCGAGGGCCAGGTCATCAACCAGCACGAG
CAGTTTCTGCGCCTCGTATCTCCCGGCTTCTTTACAGCGCCTCGCAGTCGGCTGACCAAGAAGATGGACGACAAC
ATCCGCCAGATTCAGGAGACGAGGAAACTTGCCACCAAGATCTCCATTGTCAAGCAGATGCAGGTGCAGACGCAG
GTCTACTCGAACCAGTTCCCCAAGTCCAACACGGAGCCGTTTGTGGAACAAGACATTGATTCGCATTTCATCTCG
GACAGCGGACCCGTCATAGCCCCAGAGACGTGTCAGGACGCACTCAAGCGCTCCATCGCCAAGATCCTGTACCAC
CAGGGATTCGAAGAGCTGCAGCCGTCAGCCATTGACGCCTTTACCGGCATTGCGGCCGACTACTTCCAAAAGGTA
TGCCGAACGCTGAGCATATACTGCGAGGCTGAAAAGGTGCCGGTGCAGACGCCCGAGGGATTCGAGCTGCGGTCT
CGCTTCACTCCAGAAGAGGTGGTGCTTCACACGCTGGATGAAAACGGCTTCGACGTTGGCTCGCTCGACTCGTAT
GCCAAGGACGACATGGATCGGCTGGGCAGCAAGCTGGGGGCTCTTCACGAGAGAATGAAGCTGCACCTGACGGAT
CTGCTTCGGCCCGCCTTGTCGGCGGACGCGGGCGCTGACGGGGTTGGGGCCTTTAACGACGGCAGTGAGCAATTC
ATGAGCGGCGACTTTGCCGAAGACCTGGGCGAAGACTTCTTTGGCTTCCGGGCCCTGGGTCTGGACAAGGAAATG
GGCATTGACTCGATATCCGTGCCCTTCCACTTTTTGCACAGCAGGGTGCGCAACCAGTATCAGATGCAGACCCAA
GTCAGCGGCGGATCCACGTCAAGCCTGGTGGAAGCCCTGGCGCCGCCAGACGCGGTCAACAAGGAGAACATCCAG
GACCAGATTGGCCTGGTCAAGAACTTCTTTCTGGCCAAGCTGCATGCCAACACGGATCAGGCCCTGGTTGAGGAC
GAAGACCTGCCCGTCAAGCAGCGCAAGCCACGGCCCCGCCTCGGCGCCACGGGCAAAATCATATCCGCCCAGAAG
CGTCCGCCCAGGGAGCAGCTGGCGCTGGCCAAGAAGAGGAAGAAGATGGAGCTTGCCGCCGCCGCTGCTGCCGAG
GCCAAGGCCAGCCAGGGCGCCCCGGCTGACAAGGGCGCGGCGGCCCCCAATGCCGCCAGCAGCACCCTTCCGTCC
AAGAGGAAGGCTTCCAACATTACTGCTGATGCCAACCCTCCTGCTGCTGCGCCCTCCAATGCCATGGAACGCACC
GCCAGCATGCAGAGCCAGGGCGCCAACAGCCAGACTGACAAGGAGGACACGACGGGCATGATGAGTCCGGACAGC
ATTGCTCAGTAG
Gene >OphauB2|4535
ATGTCGTTTTCAAATGGCCAGCACGCCTGGCCACCACCCGTCCTACACCATGCTTCGGCCAGTCGGTCTGTCATT
CATCTTGATGATGGTTTCGCCCGCAACCAGACCCCGGTCGACAATTCCATGACTTCGATGCCCGAAGCACCCGTC
GACATCGAAGATGAAAGTTGTCGCGCTCTATTTGCCGATCTTTATCGAAGGACCGAAGATAAGGTGGCGCTTTTG
TTTGCCAGTGATGGTTCCTACAACCGTGCTGCCATTGCTGCTCTGAAGCGAGCTTCGCCAACTCCAGCCGTGTCG
TTGCCCCCAACTACCGACCACGAACCAATTCAAGAGCCACCGCGGAAAAAAGCACGGCGCACCATTGATGAGTAC
GACTACGACGATGACGATGGCGACGACGAAGAAGATACGCAAACAGCTGCTGCCCCCGCGAAGCCGACGAGCAAC
ACGGCTGTTGCCGCTGCTGGCTCCCTTCTCTCGCCATCTAAATCGGGTAGCTCTCCGGTACACTCGGTCAACTCG
CCTGGTAGGCAGATAGACAAGTACAAGTCTGTCGAGTCGTCGCAAGGAAAAGACAAGGCCGGTGATGACTCCATC
AAGTCCCTCCAGGAAGCTCGAATGGCCACCGAAGATGCTGCTCGCCGAAGCTTCCACACCGTATTTTATACTCTA
GAAAATGACCGAACGGCAATGCTTGAGCAGCAAAGACTTGAAGATTCTGAAAAACAGCTTCAGGCAGAAATGGAT
CACAACAGCTCGTCAAACGCCGTCCAGACTGCCAATCAAGGATCCTTGAGTAGCGCCAATCTTGGCGCCTCTAGC
CTGACATTAAAGCACCTCATCGCTAGGATTGACTTGAAACGAGATCAGGTTCGCGCTTCTGATGCAGAACTACGT
CTTCTTATGAATGAAGTACGCAAGAATCGAAGTAAATGGGCCAGCGAAGAACACATTAATCAGGAAGAACTGTAC
GAGGCTCTGGAAAAGGTTCTCACTGAACTCAAAGCACATACAGAGTACTCGACGCCTTTTCTTACTCGGGTTAAT
AAAAGAGATGCTCCTGACTATTACAACTGTAAGTCAACAAGGTGTTGCTCATGTCCCCAAATAGCACAGGCAAGG
TGCAGGGCGCTCTTCATATCTAACCAAGCCTTCAGTCATCAAGAATCCCATGGACTTGGGCACAATGACGAAGAA
GCTCAAGTCTTTTACATACAAGTCAAAGACGGATTTTGTTACCGATTTGAACCTCATATGGGATAATTGCCTCAA
ATACAATCAGGACATGAACCACCCTCTTCGACGCATGGCCAATGGCATGAGAAAAGAGGCAGAAAAACTGGTGCC
CCTAATTCCTGATCTTGTGGTGCGCTCTCGAACCGATATTGAGGCCGAGGAGCGGCGCAAGCAAAACGGCGGCGA
TGACGATAATGGCGACGATTCGGATGATGAACCAATCATGTCATCGCGCGGACGGAAAGCAGCCACAAAAGGCGC
CAATAAGTCTCGGAAAGCCCCAAGCGATCATAAGGAAGAGACACCTGTGATAGACCAGAAGCCAGTCTTGCAGCT
CAACGGCCTTTTGGGTAAGGCGGGCAGAGAGAGTTCTGAGGCGGTGGATGGAAGCAATGGCTTCGCAACACCTCC
TATTGGCGGCTCAATGACTCCCAGCGGAAACGTCAACAGCCACTCGGCCTTGACCAGCAACGTAGACGCCATGGA
CATTGACGGGCCCAGCCTCAACGGCATGACTTTGAACCAGGCATTTGGAGAGGCTGTGGAGCAGCCGTATGAAGA
CGAGGAGTACAAGATTTGGAAGCAAATGACCAAGAAGGACAGGGCGTTGGCTGCCAAGGAACGCCACATGCTCTT
CAAGGAGAACAGCCTCAACGTGGAAGCTTCAGCACTGCTCAGGAGCAAGACGGACATGGGGCGGCAGCTGAAGCA
TCAGCAGGAGGCGGAAGCACTTGGTCTTGCTTCGTACCCGTACCTGGGCACCGGTTCAAGCACAGGACAAGACTC
AGGCAGCAAGACTGCAGAGACGCTGGTGGGCGGGATGGACGAAGAGGCAGAAAAGGTGCTGCCCGACTACTACGA
GACGCTAAGCCACATGCCTGACATTCCTGCAAATCTTCAGTGGGTGGAAGATGGCGAGGGCCAGGTCATCAACCA
GCACGAGCAGTTTCTGCGCCTCGTATCTCCCGGCTTCTTTACAGCGCCTCGCAGTCGGCTGACCAAGAAGATGGA
CGACAACATCCGCCAGATTCAGGAGACGAGGAAACTTGCCACCAAGATCTCCATTGTCAAGCAGATGCAGGTGCA
GACGCAGGTCTACTCGAACCAGTTCCCCAAGTCCAACACGGAGCCGTTTGTGGAACAAGACATTGATTCGCATTT
CATCTCGGACAGCGGACCCGTCATAGCCCCAGAGACGTGTCAGGACGCACTCAAGCGCTCCATCGCCAAGATCCT
GTACCACCAGGGATTCGAAGAGCTGCAGCCGTCAGCCATTGACGCCTTTACCGGCATTGCGGCCGACTACTTCCA
AAAGGTATGCCGAACGCTGAGCATATACTGCGAGGCTGAAAAGGTGCCGGTGCAGACGCCCGAGGGATTCGAGCT
GCGGTCTCGCTTCACTCCAGAAGAGGTGGTGCTTCACACGCTGGATGAAAACGGCTTCGACGTTGGCTCGCTCGA
CTCGTATGCCAAGGACGACATGGATCGGCTGGGCAGCAAGCTGGGGGCTCTTCACGAGAGAATGAAGCTGCACCT
GACGGATCTGCTTCGGCCCGCCTTGTCGGCGGACGCGGGCGCTGACGGGGTTGGGGCCTTTAACGACGGCAGTGA
GCAATTCATGAGCGGCGACTTTGCCGAAGACCTGGGCGAAGACTTCTTTGGCTTCCGGGCCCTGGGTCTGGACAA
GGAAATGGGCATTGACTCGATATCCGTGCCCTTCCACTTTTTGCACAGCAGGGTGCGCAACCAGTATCAGATGCA
GACCCAAGTCAGCGGCGGATCCACGTCAAGCCTGGTGGAAGCCCTGGCGCCGCCAGACGCGGTCAACAAGGAGAA
CATCCAGGACCAGATTGGCCTGGTCAAGAACTTCTTTCTGGCCAAGCTGCATGCCAACACGGATCAGGCCCTGGT
TGAGGACGAAGACCTGCCCGTCAAGCAGCGCAAGCCACGGCCCCGCCTCGGCGCCACGGGCAAAATCATATCCGC
CCAGAAGCGTCCGCCCAGGGAGCAGCTGGCGCTGGCCAAGAAGAGGAAGAAGATGGAGCTTGCCGCCGCCGCTGC
TGCCGAGGCCAAGGCCAGCCAGGGCGCCCCGGCTGACAAGGGCGCGGCGGCCCCCAATGCCGCCAGCAGCACCCT
TCCGTCCAAGAGGAAGGCTTCCAACATTACTGCTGATGCCAACCCTCCTGCTGCTGCGCCCTCCAATGCCATGGA
ACGCACCGCCAGCATGCAGAGCCAGGGCGCCAACAGCCAGACTGACAAGGAGGACACGACGGGCATGATGAGTCC
GGACAGCATTGCTCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail