Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4534
Gene name
LocationContig_30:39691..40364
Strand-
Gene length (bp)673
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04892 VanZ VanZ like family 5.1E-07 34 110

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13689|YDYA_SCHPO Uncharacterized protein C11E3.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11E3.10 PE=4 SV=2 3 138 5.0E-27

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 36 53 17
3 65 84 19
4 94 111 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4534
MRIRLPFAGVFLLLLLAAAYAGLTTLQLGQYVNDKALHLVTFFLLTIVFYWIVDTNRRRTQNMTFVICTLVLGIG
SEFLQSFLPNDRDFDLYDIVANIVGSLAGLGLCSLYHKRMLERRRQRKTYNAVPGESDADIELGEEHETGITDEP
SHARSLEAEIDNWDENAADDWDENDNDQALPLPGAKGTEHDNLDAKENKRRTD*
Coding >OphauB2|4534
ATGCGCATACGCTTACCCTTTGCTGGCGTCTTTTTGCTCCTACTTCTGGCCGCCGCTTACGCTGGTCTAACAACC
CTTCAACTTGGCCAATATGTCAACGACAAAGCCCTGCACCTCGTCACATTTTTCCTCCTTACGATTGTTTTCTAC
TGGATCGTCGATACTAATCGTCGCCGTACCCAAAACATGACATTTGTCATCTGTACTCTGGTACTAGGCATTGGT
TCCGAGTTCCTTCAAAGCTTCCTACCAAACGACCGCGATTTTGATCTGTATGATATTGTGGCCAATATAGTGGGC
AGCCTTGCGGGCCTGGGATTATGTTCCTTGTACCATAAGCGCATGCTCGAGCGAAGGAGACAACGCAAGACTTAC
AACGCGGTTCCTGGCGAGAGCGATGCAGACATCGAGCTCGGAGAAGAACACGAGACTGGAATCACAGATGAACCA
TCACATGCGCGATCTCTGGAAGCTGAGATTGACAACTGGGATGAGAATGCAGCGGATGATTGGGACGAGAATGAC
AATGATCAAGCACTGCCTCTTCCAGGCGCCAAGGGCACGGAACATGACAATCTGGACGCAAAGGAGAATAAGAGA
AGGACAGATTGA
Transcript >OphauB2|4534
ATGCGCATACGCTTACCCTTTGCTGGCGTCTTTTTGCTCCTACTTCTGGCCGCCGCTTACGCTGGTCTAACAACC
CTTCAACTTGGCCAATATGTCAACGACAAAGCCCTGCACCTCGTCACATTTTTCCTCCTTACGATTGTTTTCTAC
TGGATCGTCGATACTAATCGTCGCCGTACCCAAAACATGACATTTGTCATCTGTACTCTGGTACTAGGCATTGGT
TCCGAGTTCCTTCAAAGCTTCCTACCAAACGACCGCGATTTTGATCTGTATGATATTGTGGCCAATATAGTGGGC
AGCCTTGCGGGCCTGGGATTATGTTCCTTGTACCATAAGCGCATGCTCGAGCGAAGGAGACAACGCAAGACTTAC
AACGCGGTTCCTGGCGAGAGCGATGCAGACATCGAGCTCGGAGAAGAACACGAGACTGGAATCACAGATGAACCA
TCACATGCGCGATCTCTGGAAGCTGAGATTGACAACTGGGATGAGAATGCAGCGGATGATTGGGACGAGAATGAC
AATGATCAAGCACTGCCTCTTCCAGGCGCCAAGGGCACGGAACATGACAATCTGGACGCAAAGGAGAATAAGAGA
AGGACAGATTGA
Gene >OphauB2|4534
ATGCGCATACGCTTACCCTTTGCTGGTACAGACAATTGCTATTTCGACTCGTCTTATTCAACGTGCATGTGTTGA
TGCGGCTCTAGGCGTCTTTTTGCTCCTACTTCTGGCCGCCGCTTACGCTGGTCTAACAACCCTTCAACTTGGCCA
ATATGTCAACGACAAAGCCCTGCACCTCGTCACATTTTTCCTCCTTACGATTGTTTTCTACTGGATCGTCGATAC
TAATCGTCGCCGTACCCAAAACATGACATTTGTCATCTGTACTCTGGTACTAGGCATTGGTTCCGAGTTCCTTCA
AAGCTTCCTACCAAACGACCGCGATTTTGATCTGTATGATATTGTGGCCAATATAGTGGGCAGCCTTGCGGGCCT
GGGATTATGTTCCTTGTACCATAAGCGCATGCTCGAGCGAAGGAGACAACGCAAGACTTACAACGCGGTTCCTGG
CGAGAGCGATGCAGACATCGAGCTCGGAGAAGAACACGAGACTGGAATCACAGATGAACCATCACATGCGCGATC
TCTGGAAGCTGAGATTGACAACTGGGATGAGAATGCAGCGGATGATTGGGACGAGAATGACAATGATCAAGCACT
GCCTCTTCCAGGCGCCAAGGGCACGGAACATGACAATCTGGACGCAAAGGAGAATAAGAGAAGGACAGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail