Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4533
Gene name
LocationContig_30:38058..38984
Strand-
Gene length (bp)926
Transcript length (bp)624
Coding sequence length (bp)624
Protein length (aa) 208

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02996 Prefoldin Prefoldin subunit 1.5E-34 56 178

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10143|PFD3_SCHPO Probable prefoldin subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H8.07c PE=3 SV=1 18 188 1.0E-55
sp|P61759|PFD3_MOUSE Prefoldin subunit 3 OS=Mus musculus GN=Vbp1 PE=1 SV=2 7 186 3.0E-48
sp|Q5RCG9|PFD3_PONAB Prefoldin subunit 3 OS=Pongo abelii GN=VBP1 PE=2 SV=1 22 186 5.0E-48
sp|Q2TBX2|PFD3_BOVIN Prefoldin subunit 3 OS=Bos taurus GN=VBP1 PE=2 SV=1 22 186 1.0E-47
sp|P61758|PFD3_HUMAN Prefoldin subunit 3 OS=Homo sapiens GN=VBP1 PE=1 SV=3 22 186 2.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10143|PFD3_SCHPO Probable prefoldin subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H8.07c PE=3 SV=1 18 188 1.0E-55
sp|P61759|PFD3_MOUSE Prefoldin subunit 3 OS=Mus musculus GN=Vbp1 PE=1 SV=2 7 186 3.0E-48
sp|Q5RCG9|PFD3_PONAB Prefoldin subunit 3 OS=Pongo abelii GN=VBP1 PE=2 SV=1 22 186 5.0E-48
sp|Q2TBX2|PFD3_BOVIN Prefoldin subunit 3 OS=Bos taurus GN=VBP1 PE=2 SV=1 22 186 1.0E-47
sp|P61758|PFD3_HUMAN Prefoldin subunit 3 OS=Homo sapiens GN=VBP1 PE=1 SV=3 22 186 2.0E-47
sp|P57741|PFD3_ARATH Probable prefoldin subunit 3 OS=Arabidopsis thaliana GN=At5g49510 PE=1 SV=1 17 188 2.0E-41
sp|P48363|PFD3_YEAST Prefoldin subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAC10 PE=1 SV=1 15 186 1.0E-40
sp|Q9VGP6|PFD3_DROME Prefoldin subunit 3 OS=Drosophila melanogaster GN=mgr PE=1 SV=3 22 184 2.0E-36
sp|Q54LS2|PFD3_DICDI Probable prefoldin subunit 3 OS=Dictyostelium discoideum GN=pfdn3 PE=3 SV=1 14 190 4.0E-32
sp|O18054|PFD3_CAEEL Probable prefoldin subunit 3 OS=Caenorhabditis elegans GN=pfd-3 PE=3 SV=1 19 192 4.0E-24
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4533
MASSDKANESSAKEATLSNPRGIPRAPFVDKVEDYVATRQDVEPTLRNFQEMISKYQFMEMNLQRRTAGLKDKIP
DIRKTLDTVQFLKLRKDATEPIETTFELNETLYARAKIPPTDEVYIWLGANVMLSYSIEEAETLLSTKLVTAQTS
LSNCDEDLDFLREQITTMEVAIARVYNWEVMQKRKDKVEGNGDVEASKSGETVPSNQ*
Coding >OphauB2|4533
ATGGCAAGCTCAGACAAAGCCAACGAATCAAGTGCGAAGGAGGCGACTTTGAGCAATCCTAGAGGCATTCCACGG
GCACCGTTTGTTGACAAGGTCGAAGATTATGTCGCGACACGGCAAGATGTCGAACCAACATTACGCAACTTCCAG
GAGATGATATCAAAATACCAGTTCATGGAAATGAATCTCCAGCGTCGAACGGCTGGCTTAAAGGACAAAATTCCT
GATATTCGAAAAACACTAGACACAGTACAGTTTTTAAAGTTAAGAAAAGACGCTACTGAGCCCATTGAGACAACC
TTTGAGCTCAACGAGACTCTGTACGCTCGGGCGAAAATCCCACCGACCGACGAAGTGTATATCTGGCTTGGAGCC
AATGTGATGCTTTCATATTCTATTGAGGAGGCCGAAACACTACTGAGCACGAAATTAGTGACAGCGCAAACCAGC
TTGTCCAATTGTGACGAAGACCTGGACTTTCTACGAGAGCAGATTACGACTATGGAGGTAGCGATTGCAAGAGTG
TATAACTGGGAGGTGATGCAGAAACGCAAAGACAAGGTCGAGGGAAACGGCGATGTTGAGGCGTCCAAAAGCGGT
GAAACCGTTCCAAGTAATCAATGA
Transcript >OphauB2|4533
ATGGCAAGCTCAGACAAAGCCAACGAATCAAGTGCGAAGGAGGCGACTTTGAGCAATCCTAGAGGCATTCCACGG
GCACCGTTTGTTGACAAGGTCGAAGATTATGTCGCGACACGGCAAGATGTCGAACCAACATTACGCAACTTCCAG
GAGATGATATCAAAATACCAGTTCATGGAAATGAATCTCCAGCGTCGAACGGCTGGCTTAAAGGACAAAATTCCT
GATATTCGAAAAACACTAGACACAGTACAGTTTTTAAAGTTAAGAAAAGACGCTACTGAGCCCATTGAGACAACC
TTTGAGCTCAACGAGACTCTGTACGCTCGGGCGAAAATCCCACCGACCGACGAAGTGTATATCTGGCTTGGAGCC
AATGTGATGCTTTCATATTCTATTGAGGAGGCCGAAACACTACTGAGCACGAAATTAGTGACAGCGCAAACCAGC
TTGTCCAATTGTGACGAAGACCTGGACTTTCTACGAGAGCAGATTACGACTATGGAGGTAGCGATTGCAAGAGTG
TATAACTGGGAGGTGATGCAGAAACGCAAAGACAAGGTCGAGGGAAACGGCGATGTTGAGGCGTCCAAAAGCGGT
GAAACCGTTCCAAGTAATCAATGA
Gene >OphauB2|4533
ATGGCAAGCTCAGACAAAGCCAACGAATCAAGGCAAGTTTTGACCTCCCCCAAGCAAGCAAAGCGACCATCATTG
AATACCTGGCTGACAACGGCGGCTGCAGTGCGAAGGAGGCGACTTTGAGCAATCCTAGAGGCATTCCACGGGCAC
CGTTTGTTGACAAGGTCGAAGATTATGTCGCGACACGGCAAGATGTCGAACCAACATTACGCAACTTCCAGGAGA
TGATATCGTGAGTCCGCGGCGATAGAGAGCATTTGGGCCTAGTTTTGACGAGCGTCCTCTAGAAAATACCAGTTC
ATGGAAATGAATCTCCAGCGTCGAACGGCTGGCTTAAAGGACAAAATTCCTGATATTCGAAAAACACTAGACACA
GTACAGTTTTTAAAGTTAAGAAAAGTACGCACAACGGTCGAATCCAAGGCAAGGCAACGCTTACGCTTTGGCTAG
GACGCTACTGAGCCCATTGAGACAACCTTTGAGCTCAACGAGACTCTGTACGCTCGGGCGAAAATCCCACCGACC
GACGAAGTGTATATCTGGCTTGGAGTGCGAAGCCATGACTTTATAAGACTTTTGACTTTGGAAGAAATAGCAGCT
AACGGAAACATAGGCCAATGTGATGCTTTCATATTCTATTGAGGAGGCCGAAACACTACTGAGCACGAAATTAGT
GACAGCGCAAACCAGCTTGTCCAATTGTGACGAAGACCTGGACTTTCTACGAGAGCAGATTACGGTACGTGTGGA
AAAGTATGCTTTTGAGGCCAATGGAATCAAGCTAATGCTCTGGTGGCAAGACTATGGAGGTAGCGATTGCAAGAG
TGTATAACTGGGAGGTGATGCAGAAACGCAAAGACAAGGTCGAGGGAAACGGCGATGTTGAGGCGTCCAAAAGCG
GTGAAACCGTTCCAAGTAATCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail