Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4529
Gene name
LocationContig_30:28084..29887
Strand+
Gene length (bp)1803
Transcript length (bp)1803
Coding sequence length (bp)1803
Protein length (aa) 601

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 3.7E-08 346 403
PF13540 RCC1_2 Regulator of chromosome condensation (RCC1) repeat 2.0E-09 329 358

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08023|FMP25_YEAST Protein FMP25, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP25 PE=4 SV=1 117 543 1.0E-30
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 263 402 3.0E-10
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 263 402 1.0E-09
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 263 402 2.0E-09
sp|P28745|RCC1_SCHPO Protein pim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pim1 PE=1 SV=2 118 361 5.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08023|FMP25_YEAST Protein FMP25, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP25 PE=4 SV=1 117 543 1.0E-30
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 263 402 3.0E-10
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 263 402 1.0E-09
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 263 402 2.0E-09
sp|P28745|RCC1_SCHPO Protein pim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pim1 PE=1 SV=2 118 361 5.0E-09
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 268 402 6.0E-09
sp|Q8BTU7|RCCD1_MOUSE RCC1 domain-containing protein 1 OS=Mus musculus GN=Rccd1 PE=2 SV=2 264 444 2.0E-08
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 124 443 3.0E-08
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 124 443 4.0E-08
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 124 443 6.0E-08
sp|F2Z461|HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 268 361 8.0E-08
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 263 459 9.0E-08
sp|Q4R828|RCCD1_MACFA RCC1 domain-containing protein 1 OS=Macaca fascicularis GN=RCCD1 PE=2 SV=1 251 412 1.0E-07
sp|P18754|RCC1_HUMAN Regulator of chromosome condensation OS=Homo sapiens GN=RCC1 PE=1 SV=1 171 399 3.0E-07
sp|F2Z461|HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 241 402 4.0E-07
sp|A6NED2|RCCD1_HUMAN RCC1 domain-containing protein 1 OS=Homo sapiens GN=RCCD1 PE=1 SV=1 251 444 5.0E-07
sp|Q5RCZ7|RCBT2_PONAB RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 70 380 8.0E-07
sp|O95199|RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=1 SV=1 70 380 8.0E-07
sp|Q8SSY6|SPKUL_DICDI Bifunctional serine/threonine-protein kinase/NEDD4-like E3 ubiquitin-protein ligase OS=Dictyostelium discoideum GN=DDB_G0276527 PE=3 SV=2 239 382 4.0E-06
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 121 395 4.0E-06
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 121 376 5.0E-06
sp|P23800|RCC1_MESAU Regulator of chromosome condensation OS=Mesocricetus auratus GN=RCC1 PE=1 SV=1 171 399 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4529
MKPSHGALGHAARLGSSIGRPIVASPGLWLRHASTTTSRRQPRPRHTAKVAACAAVLAVAAASAYYYSHLFKEQS
SEPQAAAKAELEFEKPRKLPLSKEENRELISSQHLQVKNSWEHPGVYLWGSNVGKVVDPGSDDKVVKLPRRLVYL
DGQLLRDIKLKQNFGAAITENGDLIQWGVAFSKADARPDKTLTGKDLVKLSVSADRIIALSRAGAVYSVPASRSD
LLEGAKLDRKSSWSLWSSGGKETLSFRELTPAKLSRGEKIVQVSSGLEHCLMLTNKGRVFSAASSTLSFPSRGQM
GIPGLEWETRPAGAYDQAHEMQTLSGIKVEQIATGDYHSVVLDKLGRVFSFGDNTYGQLGLETDGAMVSVSAPTM
VNVNKLYAKSGLVPKVSMIEAGGSNTFFAVDVEMPLGHGTSQAVAPARRMPQGVSDVWACGHGVTGALGTGKWTH
VSVAPTKIKALSSLMEFNEASNKMVPIRLKALSVGSTHCSAVMDNVTETSISQRSSKPETNWGADVVFWGGNEYF
QLGTGKRSNMNTPGYIGPLDGGEGDEEKGRKGEVHRLCLTPRQTARLGPGAQGRKATLEQKVECGQFVTGVYSAV
*
Coding >OphauB2|4529
ATGAAGCCTTCACATGGAGCCCTCGGGCACGCAGCTCGCTTGGGCAGCTCGATAGGGCGGCCAATCGTCGCCTCA
CCAGGACTGTGGCTTCGACACGCCAGCACCACTACCTCCCGACGACAGCCTCGTCCACGCCACACAGCCAAGGTA
GCTGCTTGTGCCGCCGTCCTGGCCGTTGCAGCAGCGAGCGCGTACTACTATTCCCACCTCTTCAAGGAACAGTCT
TCGGAACCGCAAGCCGCAGCAAAGGCTGAGCTGGAGTTTGAAAAGCCACGCAAGCTGCCACTGTCCAAGGAGGAA
AACAGGGAGCTTATCAGTTCGCAGCACCTCCAGGTCAAAAATAGCTGGGAGCATCCGGGAGTTTATCTCTGGGGG
TCCAATGTGGGAAAGGTGGTGGATCCAGGCTCCGACGACAAGGTTGTCAAGCTGCCTCGAAGACTTGTCTACTTG
GATGGCCAGCTCTTGAGAGACATCAAGCTCAAGCAAAATTTCGGGGCTGCCATTACGGAAAACGGAGATCTCATA
CAATGGGGCGTGGCCTTTTCCAAGGCAGATGCACGGCCAGATAAAACGCTCACGGGCAAAGACTTGGTCAAGCTT
AGCGTGTCGGCTGATCGCATCATTGCGCTGTCTCGCGCAGGGGCCGTGTACTCGGTACCGGCATCGCGCAGTGAC
CTGCTGGAGGGTGCCAAGCTTGACAGGAAAAGCTCGTGGTCTCTGTGGAGCTCTGGTGGAAAAGAGACGTTGAGC
TTCCGAGAACTGACGCCGGCCAAGCTGAGTCGGGGCGAAAAGATTGTCCAAGTCAGCAGCGGACTGGAGCACTGC
CTCATGCTGACCAACAAGGGACGCGTGTTTTCTGCGGCTTCAAGCACTCTCTCGTTCCCCTCTCGTGGACAAATG
GGCATTCCTGGTCTTGAGTGGGAGACAAGACCAGCCGGGGCGTACGACCAAGCTCACGAGATGCAGACGCTGTCA
GGGATCAAGGTGGAACAAATTGCTACAGGTGACTATCACTCTGTAGTCCTGGACAAGCTGGGGAGGGTATTCTCC
TTTGGCGACAACACGTACGGGCAGCTGGGGCTCGAGACAGATGGCGCCATGGTCAGTGTGTCTGCGCCGACAATG
GTCAATGTCAACAAACTCTACGCCAAGAGTGGCTTGGTGCCCAAGGTGAGCATGATTGAAGCCGGAGGCAGCAAT
ACTTTCTTCGCTGTGGATGTCGAAATGCCATTGGGCCATGGCACGAGCCAGGCAGTAGCGCCGGCTAGACGGATG
CCTCAGGGTGTATCGGATGTCTGGGCCTGTGGGCATGGCGTGACGGGAGCGCTAGGCACGGGCAAGTGGACACAC
GTGTCGGTAGCGCCAACCAAGATCAAGGCGCTGTCGTCGCTCATGGAGTTTAACGAGGCAAGCAACAAGATGGTG
CCCATCAGGCTCAAGGCCTTGAGCGTGGGATCGACACACTGCTCGGCCGTCATGGACAATGTGACGGAGACGAGC
ATCTCGCAGCGGTCGAGCAAACCCGAAACCAACTGGGGCGCCGACGTTGTGTTTTGGGGTGGCAATGAGTATTTC
CAGCTGGGGACTGGCAAGCGGTCCAATATGAACACGCCGGGTTACATTGGGCCACTGGACGGTGGCGAAGGCGAC
GAGGAAAAGGGGCGCAAGGGCGAGGTGCACCGTCTGTGTCTAACACCGCGACAGACGGCGCGGCTGGGACCCGGA
GCCCAGGGCCGCAAGGCGACGCTGGAGCAAAAGGTCGAATGTGGTCAGTTTGTGACGGGAGTCTACTCTGCGGTG
TGA
Transcript >OphauB2|4529
ATGAAGCCTTCACATGGAGCCCTCGGGCACGCAGCTCGCTTGGGCAGCTCGATAGGGCGGCCAATCGTCGCCTCA
CCAGGACTGTGGCTTCGACACGCCAGCACCACTACCTCCCGACGACAGCCTCGTCCACGCCACACAGCCAAGGTA
GCTGCTTGTGCCGCCGTCCTGGCCGTTGCAGCAGCGAGCGCGTACTACTATTCCCACCTCTTCAAGGAACAGTCT
TCGGAACCGCAAGCCGCAGCAAAGGCTGAGCTGGAGTTTGAAAAGCCACGCAAGCTGCCACTGTCCAAGGAGGAA
AACAGGGAGCTTATCAGTTCGCAGCACCTCCAGGTCAAAAATAGCTGGGAGCATCCGGGAGTTTATCTCTGGGGG
TCCAATGTGGGAAAGGTGGTGGATCCAGGCTCCGACGACAAGGTTGTCAAGCTGCCTCGAAGACTTGTCTACTTG
GATGGCCAGCTCTTGAGAGACATCAAGCTCAAGCAAAATTTCGGGGCTGCCATTACGGAAAACGGAGATCTCATA
CAATGGGGCGTGGCCTTTTCCAAGGCAGATGCACGGCCAGATAAAACGCTCACGGGCAAAGACTTGGTCAAGCTT
AGCGTGTCGGCTGATCGCATCATTGCGCTGTCTCGCGCAGGGGCCGTGTACTCGGTACCGGCATCGCGCAGTGAC
CTGCTGGAGGGTGCCAAGCTTGACAGGAAAAGCTCGTGGTCTCTGTGGAGCTCTGGTGGAAAAGAGACGTTGAGC
TTCCGAGAACTGACGCCGGCCAAGCTGAGTCGGGGCGAAAAGATTGTCCAAGTCAGCAGCGGACTGGAGCACTGC
CTCATGCTGACCAACAAGGGACGCGTGTTTTCTGCGGCTTCAAGCACTCTCTCGTTCCCCTCTCGTGGACAAATG
GGCATTCCTGGTCTTGAGTGGGAGACAAGACCAGCCGGGGCGTACGACCAAGCTCACGAGATGCAGACGCTGTCA
GGGATCAAGGTGGAACAAATTGCTACAGGTGACTATCACTCTGTAGTCCTGGACAAGCTGGGGAGGGTATTCTCC
TTTGGCGACAACACGTACGGGCAGCTGGGGCTCGAGACAGATGGCGCCATGGTCAGTGTGTCTGCGCCGACAATG
GTCAATGTCAACAAACTCTACGCCAAGAGTGGCTTGGTGCCCAAGGTGAGCATGATTGAAGCCGGAGGCAGCAAT
ACTTTCTTCGCTGTGGATGTCGAAATGCCATTGGGCCATGGCACGAGCCAGGCAGTAGCGCCGGCTAGACGGATG
CCTCAGGGTGTATCGGATGTCTGGGCCTGTGGGCATGGCGTGACGGGAGCGCTAGGCACGGGCAAGTGGACACAC
GTGTCGGTAGCGCCAACCAAGATCAAGGCGCTGTCGTCGCTCATGGAGTTTAACGAGGCAAGCAACAAGATGGTG
CCCATCAGGCTCAAGGCCTTGAGCGTGGGATCGACACACTGCTCGGCCGTCATGGACAATGTGACGGAGACGAGC
ATCTCGCAGCGGTCGAGCAAACCCGAAACCAACTGGGGCGCCGACGTTGTGTTTTGGGGTGGCAATGAGTATTTC
CAGCTGGGGACTGGCAAGCGGTCCAATATGAACACGCCGGGTTACATTGGGCCACTGGACGGTGGCGAAGGCGAC
GAGGAAAAGGGGCGCAAGGGCGAGGTGCACCGTCTGTGTCTAACACCGCGACAGACGGCGCGGCTGGGACCCGGA
GCCCAGGGCCGCAAGGCGACGCTGGAGCAAAAGGTCGAATGTGGTCAGTTTGTGACGGGAGTCTACTCTGCGGTG
TGA
Gene >OphauB2|4529
ATGAAGCCTTCACATGGAGCCCTCGGGCACGCAGCTCGCTTGGGCAGCTCGATAGGGCGGCCAATCGTCGCCTCA
CCAGGACTGTGGCTTCGACACGCCAGCACCACTACCTCCCGACGACAGCCTCGTCCACGCCACACAGCCAAGGTA
GCTGCTTGTGCCGCCGTCCTGGCCGTTGCAGCAGCGAGCGCGTACTACTATTCCCACCTCTTCAAGGAACAGTCT
TCGGAACCGCAAGCCGCAGCAAAGGCTGAGCTGGAGTTTGAAAAGCCACGCAAGCTGCCACTGTCCAAGGAGGAA
AACAGGGAGCTTATCAGTTCGCAGCACCTCCAGGTCAAAAATAGCTGGGAGCATCCGGGAGTTTATCTCTGGGGG
TCCAATGTGGGAAAGGTGGTGGATCCAGGCTCCGACGACAAGGTTGTCAAGCTGCCTCGAAGACTTGTCTACTTG
GATGGCCAGCTCTTGAGAGACATCAAGCTCAAGCAAAATTTCGGGGCTGCCATTACGGAAAACGGAGATCTCATA
CAATGGGGCGTGGCCTTTTCCAAGGCAGATGCACGGCCAGATAAAACGCTCACGGGCAAAGACTTGGTCAAGCTT
AGCGTGTCGGCTGATCGCATCATTGCGCTGTCTCGCGCAGGGGCCGTGTACTCGGTACCGGCATCGCGCAGTGAC
CTGCTGGAGGGTGCCAAGCTTGACAGGAAAAGCTCGTGGTCTCTGTGGAGCTCTGGTGGAAAAGAGACGTTGAGC
TTCCGAGAACTGACGCCGGCCAAGCTGAGTCGGGGCGAAAAGATTGTCCAAGTCAGCAGCGGACTGGAGCACTGC
CTCATGCTGACCAACAAGGGACGCGTGTTTTCTGCGGCTTCAAGCACTCTCTCGTTCCCCTCTCGTGGACAAATG
GGCATTCCTGGTCTTGAGTGGGAGACAAGACCAGCCGGGGCGTACGACCAAGCTCACGAGATGCAGACGCTGTCA
GGGATCAAGGTGGAACAAATTGCTACAGGTGACTATCACTCTGTAGTCCTGGACAAGCTGGGGAGGGTATTCTCC
TTTGGCGACAACACGTACGGGCAGCTGGGGCTCGAGACAGATGGCGCCATGGTCAGTGTGTCTGCGCCGACAATG
GTCAATGTCAACAAACTCTACGCCAAGAGTGGCTTGGTGCCCAAGGTGAGCATGATTGAAGCCGGAGGCAGCAAT
ACTTTCTTCGCTGTGGATGTCGAAATGCCATTGGGCCATGGCACGAGCCAGGCAGTAGCGCCGGCTAGACGGATG
CCTCAGGGTGTATCGGATGTCTGGGCCTGTGGGCATGGCGTGACGGGAGCGCTAGGCACGGGCAAGTGGACACAC
GTGTCGGTAGCGCCAACCAAGATCAAGGCGCTGTCGTCGCTCATGGAGTTTAACGAGGCAAGCAACAAGATGGTG
CCCATCAGGCTCAAGGCCTTGAGCGTGGGATCGACACACTGCTCGGCCGTCATGGACAATGTGACGGAGACGAGC
ATCTCGCAGCGGTCGAGCAAACCCGAAACCAACTGGGGCGCCGACGTTGTGTTTTGGGGTGGCAATGAGTATTTC
CAGCTGGGGACTGGCAAGCGGTCCAATATGAACACGCCGGGTTACATTGGGCCACTGGACGGTGGCGAAGGCGAC
GAGGAAAAGGGGCGCAAGGGCGAGGTGCACCGTCTGTGTCTAACACCGCGACAGACGGCGCGGCTGGGACCCGGA
GCCCAGGGCCGCAAGGCGACGCTGGAGCAAAAGGTCGAATGTGGTCAGTTTGTGACGGGAGTCTACTCTGCGGTG
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail