Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4528
Gene name
LocationContig_30:25165..27717
Strand-
Gene length (bp)2552
Transcript length (bp)2307
Coding sequence length (bp)2307
Protein length (aa) 769

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04136 Sec34 Sec34-like family 3.1E-44 148 294

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7Z4|COG3_SCHPO Conserved oligomeric Golgi complex subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cog3 PE=3 SV=1 158 687 1.0E-14
sp|Q8CI04|COG3_MOUSE Conserved oligomeric Golgi complex subunit 3 OS=Mus musculus GN=Cog3 PE=1 SV=3 143 282 8.0E-13
sp|Q96JB2|COG3_HUMAN Conserved oligomeric Golgi complex subunit 3 OS=Homo sapiens GN=COG3 PE=1 SV=3 143 318 1.0E-12
sp|Q29N70|COG3_DROPS Conserved oligomeric Golgi complex subunit 3 OS=Drosophila pseudoobscura pseudoobscura GN=Cog3 PE=3 SV=1 143 319 2.0E-11
sp|Q961G1|COG3_DROME Conserved oligomeric Golgi complex subunit 3 OS=Drosophila melanogaster GN=Cog3 PE=1 SV=1 139 319 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7Z4|COG3_SCHPO Conserved oligomeric Golgi complex subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cog3 PE=3 SV=1 158 687 1.0E-14
sp|Q8CI04|COG3_MOUSE Conserved oligomeric Golgi complex subunit 3 OS=Mus musculus GN=Cog3 PE=1 SV=3 143 282 8.0E-13
sp|Q96JB2|COG3_HUMAN Conserved oligomeric Golgi complex subunit 3 OS=Homo sapiens GN=COG3 PE=1 SV=3 143 318 1.0E-12
sp|Q29N70|COG3_DROPS Conserved oligomeric Golgi complex subunit 3 OS=Drosophila pseudoobscura pseudoobscura GN=Cog3 PE=3 SV=1 143 319 2.0E-11
sp|Q961G1|COG3_DROME Conserved oligomeric Golgi complex subunit 3 OS=Drosophila melanogaster GN=Cog3 PE=1 SV=1 139 319 3.0E-11
sp|P40094|COG3_YEAST Conserved oligomeric Golgi complex subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COG3 PE=1 SV=1 144 385 4.0E-09
sp|Q16ZN9|COG3_AEDAE Conserved oligomeric Golgi complex subunit 3 OS=Aedes aegypti GN=Cog3 PE=3 SV=1 144 319 1.0E-08
sp|Q54TT4|COG3_DICDI Conserved oligomeric Golgi complex subunit 3 OS=Dictyostelium discoideum GN=cog3 PE=3 SV=1 171 307 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0005801 cis-Golgi network Yes
GO:0016020 membrane Yes
GO:0051641 cellular localization No
GO:0043229 intracellular organelle No
GO:0046907 intracellular transport No
GO:0070727 cellular macromolecule localization No
GO:0005575 cellular_component No
GO:0045184 establishment of protein localization No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0071702 organic substance transport No
GO:0015031 protein transport No
GO:0033036 macromolecule localization No
GO:0051179 localization No
GO:0043226 organelle No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0043227 membrane-bounded organelle No
GO:0071705 nitrogen compound transport No
GO:0009987 cellular process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0051234 establishment of localization No
GO:0008104 protein localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4528
MYEDSWYSFVPDVASKTQPLQSQSLPHGRTESRLQQPNGIARAQDSLAPLSQALGHGSSSESPPEPQVPRRAASF
PCLHRVASTQLTRDGASCAPGHIERGRTRLFEALMLQHQGSMARLVGADEVARDELANETLLLASQQQYLHQQDQ
LALTERHLDGLIEEANAALALLTSLSTSFQSVQSQTSSFQSQCQDIISEQHRLEKLVDQVGTDLHYYAYLDIATR
RLNAPGASRLVESADLGDLIENIDACIHFMDSHDSYRERDSYLARYNALLAKALHLLDHGFTAHLNKVSLELSRQ
MDTLKSSSARHALAYGRFEEIMSGSFYLLPNIQKTVRCAYDEYGRPAEASPRRDVYANSALAMFRTYLQTRDRDL
KAMTQHEMDEFQKECKTLSIETACRNYIKQSFEKIDDEDVLFFKIFSVEPTWNNSPDSVLQAIRTVHTSMVHRGH
LIPLANCIQSSLNNAKIEAICSVVGWLASEYTVPELDEEESPTSRRFREYAARLLVDHLWTFTDNAFATEITKSI
TKAPLTDGSLKMEPAVGGVASSNAHPLVNKAIDLLAMFDRAMPKERSAKNSPVVFSIVRETIHVLQRAESRINSL
HNGTDGDLFMVKNLLIIKNELVSLEIGDIRSQAPSMQHFGHIWDRLSPQNWMSFFSGLVSAGGSLWARSGSSVTA
KTLTAEDMSEQLDELLRQSIYAFTKRWGSLMNDSRSHKAGSKPIAKLETELEAILDAAFNGQPEVVSKLKEAIEL
NAQAQSNAQDEKRGAKRY*
Coding >OphauB2|4528
ATGTACGAAGACTCGTGGTACAGTTTCGTGCCCGATGTTGCCAGCAAAACACAACCACTCCAAAGCCAATCGCTG
CCCCACGGTCGAACCGAATCTCGGCTTCAGCAGCCCAACGGCATTGCCAGAGCCCAAGATTCTCTTGCGCCCTTG
TCCCAAGCTCTTGGTCATGGCAGCAGCTCTGAATCACCTCCCGAGCCACAAGTGCCTCGGCGCGCCGCCTCTTTC
CCCTGCTTGCATCGTGTGGCGTCGACGCAATTGACAAGGGATGGAGCCTCGTGCGCCCCTGGGCACATAGAGCGA
GGCCGCACCAGGCTGTTCGAGGCCCTGATGCTGCAGCATCAAGGCTCCATGGCCAGACTTGTCGGCGCAGACGAG
GTAGCCCGTGACGAGTTGGCTAATGAGACATTGCTGCTAGCCAGCCAACAGCAGTATCTCCACCAGCAAGACCAA
CTCGCCCTCACCGAGCGCCATCTCGACGGCCTCATTGAAGAAGCCAATGCGGCCCTGGCGCTTCTCACTTCTCTT
TCCACCTCTTTTCAGTCGGTCCAGTCTCAAACGTCGTCCTTCCAGTCCCAGTGCCAAGACATCATCTCGGAGCAG
CATCGCCTAGAGAAGCTTGTCGACCAAGTTGGCACCGATTTACACTACTATGCCTACCTGGACATTGCCACACGT
CGTCTCAATGCTCCTGGAGCCAGCCGCCTGGTTGAGTCGGCGGACCTGGGCGACTTGATTGAGAACATTGATGCC
TGTATTCACTTCATGGACTCCCACGACTCTTACCGCGAGCGTGACTCATACCTGGCAAGATACAATGCCCTCCTG
GCAAAGGCTTTGCATCTGCTCGATCATGGCTTCACTGCTCATTTGAACAAGGTTTCACTCGAGCTTTCCCGCCAA
ATGGATACCCTCAAGTCCAGCTCAGCCCGCCATGCCCTGGCTTATGGCCGTTTCGAGGAAATCATGTCTGGCTCG
TTTTATCTGTTACCCAATATTCAAAAAACAGTGCGCTGTGCCTACGACGAATATGGCAGACCAGCCGAAGCCTCT
CCTCGCAGAGATGTATACGCAAATTCAGCTCTAGCCATGTTTCGCACCTATCTTCAGACTAGGGACCGAGATCTA
AAGGCCATGACACAACACGAAATGGACGAATTTCAAAAAGAATGCAAAACTCTTTCTATCGAGACTGCATGCAGA
AACTACATTAAGCAGTCATTTGAAAAGATTGACGATGAAGACGTCTTGTTTTTCAAGATTTTCAGCGTAGAACCC
ACATGGAACAACTCTCCAGATTCGGTTTTGCAAGCCATTCGCACTGTCCACACATCCATGGTCCACCGGGGACAC
TTGATACCACTTGCCAATTGCATACAGAGCTCGTTGAATAATGCTAAAATCGAAGCTATCTGCAGCGTGGTGGGA
TGGCTGGCCAGCGAATACACAGTGCCAGAATTAGATGAGGAAGAGTCACCAACGAGTAGGAGATTTCGCGAGTAC
GCAGCACGCCTTCTAGTGGACCATTTGTGGACATTTACAGATAACGCTTTTGCCACGGAGATTACCAAGTCCATC
ACCAAGGCTCCGTTGACGGATGGAAGCCTCAAAATGGAGCCTGCTGTTGGGGGGGTGGCGTCGTCAAATGCACAT
CCTCTGGTAAACAAGGCAATCGATTTGCTGGCCATGTTTGATCGAGCCATGCCAAAAGAACGGTCGGCCAAGAAC
AGCCCAGTTGTTTTCAGTATTGTGCGAGAGACGATTCACGTGTTACAGCGAGCAGAATCTAGGATCAATTCGCTT
CACAACGGGACAGACGGCGATTTATTCATGGTAAAGAACCTTCTCATTATCAAGAATGAGCTCGTGTCCCTGGAA
ATTGGTGATATCCGGAGTCAGGCGCCCTCGATGCAGCATTTTGGACACATATGGGATAGACTTAGTCCGCAAAAC
TGGATGAGCTTCTTCAGCGGCCTTGTTAGCGCCGGCGGTTCTCTATGGGCGCGCAGTGGGTCGTCTGTAACGGCC
AAGACGCTGACAGCAGAGGATATGAGCGAACAACTGGATGAGCTGCTGCGACAATCTATTTACGCCTTTACCAAG
CGATGGGGCAGTTTGATGAACGACTCGCGGAGCCACAAGGCAGGGTCCAAGCCCATTGCCAAGCTCGAGACGGAA
TTGGAGGCGATATTGGATGCTGCATTCAACGGGCAGCCTGAGGTTGTATCCAAGCTCAAGGAAGCAATTGAGCTC
AATGCACAAGCACAGAGCAATGCGCAAGATGAGAAGAGGGGAGCCAAGCGATACTGA
Transcript >OphauB2|4528
ATGTACGAAGACTCGTGGTACAGTTTCGTGCCCGATGTTGCCAGCAAAACACAACCACTCCAAAGCCAATCGCTG
CCCCACGGTCGAACCGAATCTCGGCTTCAGCAGCCCAACGGCATTGCCAGAGCCCAAGATTCTCTTGCGCCCTTG
TCCCAAGCTCTTGGTCATGGCAGCAGCTCTGAATCACCTCCCGAGCCACAAGTGCCTCGGCGCGCCGCCTCTTTC
CCCTGCTTGCATCGTGTGGCGTCGACGCAATTGACAAGGGATGGAGCCTCGTGCGCCCCTGGGCACATAGAGCGA
GGCCGCACCAGGCTGTTCGAGGCCCTGATGCTGCAGCATCAAGGCTCCATGGCCAGACTTGTCGGCGCAGACGAG
GTAGCCCGTGACGAGTTGGCTAATGAGACATTGCTGCTAGCCAGCCAACAGCAGTATCTCCACCAGCAAGACCAA
CTCGCCCTCACCGAGCGCCATCTCGACGGCCTCATTGAAGAAGCCAATGCGGCCCTGGCGCTTCTCACTTCTCTT
TCCACCTCTTTTCAGTCGGTCCAGTCTCAAACGTCGTCCTTCCAGTCCCAGTGCCAAGACATCATCTCGGAGCAG
CATCGCCTAGAGAAGCTTGTCGACCAAGTTGGCACCGATTTACACTACTATGCCTACCTGGACATTGCCACACGT
CGTCTCAATGCTCCTGGAGCCAGCCGCCTGGTTGAGTCGGCGGACCTGGGCGACTTGATTGAGAACATTGATGCC
TGTATTCACTTCATGGACTCCCACGACTCTTACCGCGAGCGTGACTCATACCTGGCAAGATACAATGCCCTCCTG
GCAAAGGCTTTGCATCTGCTCGATCATGGCTTCACTGCTCATTTGAACAAGGTTTCACTCGAGCTTTCCCGCCAA
ATGGATACCCTCAAGTCCAGCTCAGCCCGCCATGCCCTGGCTTATGGCCGTTTCGAGGAAATCATGTCTGGCTCG
TTTTATCTGTTACCCAATATTCAAAAAACAGTGCGCTGTGCCTACGACGAATATGGCAGACCAGCCGAAGCCTCT
CCTCGCAGAGATGTATACGCAAATTCAGCTCTAGCCATGTTTCGCACCTATCTTCAGACTAGGGACCGAGATCTA
AAGGCCATGACACAACACGAAATGGACGAATTTCAAAAAGAATGCAAAACTCTTTCTATCGAGACTGCATGCAGA
AACTACATTAAGCAGTCATTTGAAAAGATTGACGATGAAGACGTCTTGTTTTTCAAGATTTTCAGCGTAGAACCC
ACATGGAACAACTCTCCAGATTCGGTTTTGCAAGCCATTCGCACTGTCCACACATCCATGGTCCACCGGGGACAC
TTGATACCACTTGCCAATTGCATACAGAGCTCGTTGAATAATGCTAAAATCGAAGCTATCTGCAGCGTGGTGGGA
TGGCTGGCCAGCGAATACACAGTGCCAGAATTAGATGAGGAAGAGTCACCAACGAGTAGGAGATTTCGCGAGTAC
GCAGCACGCCTTCTAGTGGACCATTTGTGGACATTTACAGATAACGCTTTTGCCACGGAGATTACCAAGTCCATC
ACCAAGGCTCCGTTGACGGATGGAAGCCTCAAAATGGAGCCTGCTGTTGGGGGGGTGGCGTCGTCAAATGCACAT
CCTCTGGTAAACAAGGCAATCGATTTGCTGGCCATGTTTGATCGAGCCATGCCAAAAGAACGGTCGGCCAAGAAC
AGCCCAGTTGTTTTCAGTATTGTGCGAGAGACGATTCACGTGTTACAGCGAGCAGAATCTAGGATCAATTCGCTT
CACAACGGGACAGACGGCGATTTATTCATGGTAAAGAACCTTCTCATTATCAAGAATGAGCTCGTGTCCCTGGAA
ATTGGTGATATCCGGAGTCAGGCGCCCTCGATGCAGCATTTTGGACACATATGGGATAGACTTAGTCCGCAAAAC
TGGATGAGCTTCTTCAGCGGCCTTGTTAGCGCCGGCGGTTCTCTATGGGCGCGCAGTGGGTCGTCTGTAACGGCC
AAGACGCTGACAGCAGAGGATATGAGCGAACAACTGGATGAGCTGCTGCGACAATCTATTTACGCCTTTACCAAG
CGATGGGGCAGTTTGATGAACGACTCGCGGAGCCACAAGGCAGGGTCCAAGCCCATTGCCAAGCTCGAGACGGAA
TTGGAGGCGATATTGGATGCTGCATTCAACGGGCAGCCTGAGGTTGTATCCAAGCTCAAGGAAGCAATTGAGCTC
AATGCACAAGCACAGAGCAATGCGCAAGATGAGAAGAGGGGAGCCAAGCGATACTGA
Gene >OphauB2|4528
ATGTACGAAGACTCGTGGTACAGTTTCGTGCCCGATGTTGCCAGCAAAACACAACCACTCCAAAGCCAATCGCTG
CCCCACGGTCGAACCGAATCTCGGCTTCAGCAGCCCAACGTTGGTCCACCTGTCTTTTGCGCGGCTTGGGCAGCA
GCTTACAGTAGTCGCTGCAGGGCATTGCCAGAGCCCAAGATTCTCTTGCGCCCTTGTCCCAAGCTCTTGGTCATG
GCAGCAGCTCTGAATCACCTCCCGAGCCACAAGTGCCTCGGCGCGCCGCCTCTTTCCCCTGCTTGCATCGTGTGG
CGTCGACGCAATTGACAAGGGATGGAGCCTCGTGCGCCCCTGGGCACATAGAGCGAGGCCGCACCAGGCTGTTCG
AGGCCCTGATGCTGCAGCATCAAGGCTCCATGGCCAGACTTGTCGGCGCAGACGAGGTAGCCCGTGACGAGTTGG
CTAATGAGACATTGCTGCTAGCCAGCCAACAGCAGTATCTGTATGGACTGAGAGCTCCCCGGCCATGAGACTGAT
GAAGCTAACCTTGGCCAGCCACCAGCAAGACCAACTCGCCCTCACCGAGCGCCATCTCGACGGCCTCATTGAAGA
AGCCAATGCGGCCCTGGCGCTTCTCACTTCTCTTTCCACCTCTTTTCAGTCGGTCCAGTCTCAAACGTCGTCCTT
CCAGTCCCAGTGCCAAGACATCATCTCGGAGCAGCATCGCCTAGAGAAGCTTGTCGACCAAGTTGGCACCGATTT
ACACTACTATGCCTACCTGGACATTGCCACACGTCGTCTCAATGCTCCTGGAGCCAGCCGCCTGGTTGAGTCGGC
GGACCTGGGCGACTTGATTGAGAACATTGATGCCTGTATTCACTTCATGGACTCCCACGTGCGTGTAGCTTTGTC
TTGTCTCGGCTTGTCTGTGCTCATGGCGACTGACCCAATCCCTGTTGCAACAGGACTCTTACCGCGAGCGTGACT
CATACCTGGCAAGATACAATGCCCTCCTGGCAAAGGCTTTGCATCTGCTCGATCATGGCTTCACTGCTCATTTGA
ACAAGGTTTCACTCGAGCTTTCCCGCCAAATGGATACCCTCAAGTCCAGCTCAGCCCGCCATGCCCTGGCTTATG
GCCGTTTCGAGGAAATCATGTCTGGCTCGTTTTATCTGTTACCCAATATTCAAAAAACAGTGCGCTGTGCCTACG
ACGAATATGGCAGACCAGCCGAAGCCTCTCCTCGCAGAGATGTATACGCAAATTCAGCTCTAGCCATGTTTCGCA
CCTATCTTCAGACTAGGGACCGAGATCTAAAGGCCATGACACAACACGAAATGGACGAATTTCAAAAAGAATGCA
AAACTCTTTCTATCGAGACTGCATGCAGAAACTACATTAAGCAGTCATTTGAAAAGATTGACGATGAAGACGTCT
TGTTTTTCAAGATTTTCAGCGTAGAACCCACATGGAACAACTCTCCAGATTCGGTTTTGCAAGCCATTCGCACTG
TCCACACATCCATGGTCCACCGGGGACACTTGATACCACTTGCCAATTGCATACAGAGCTCGTTGAATAATGCTA
AAATCGAAGCTATCTGCAGCGTGGTGGGATGGCTGGCCAGCGAATACACAGTGCCAGAATTAGATGAGGAAGAGT
CACCAACGAGTAGGAGATTTCGCGAGTACGCAGCACGCCTTCTAGTGGACCATTTGTGGACATTTACAGATAACG
CTTTTGCCACGGAGATTACCAAGTCCATCACCAAGGCTCCGTTGACGGATGGAAGCCTCAAAATGGAGCCTGCTG
TTGGGGGGGTGGCGTCGTCAAATGCACATCCTCTGGTAAACAAGGCAATCGATTTGCTGGCCATGTTTGATCGAG
CCATGCCAAAAGAACGGTCGGTGAGTTGTGTTGTGTGTCTTGCAAATATTCGTCTTGAACAGCGACTTAGACTAA
TATTGATTTAGGCCAAGAACAGCCCAGTTGTTTTCAGTATTGTGCGAGAGACGATTCACGTGTTACAGCGAGCAG
AATCTAGGATCAATTCGCTTCACAACGGGACAGACGGCGATTTATTCATGGTAAAGAACCTTCTCATTATCAAGA
ATGAGCTCGTGTCCCTGGAAATTGGTGATATCCGGAGTCAGGCGCCCTCGATGCAGCATTTTGGACACATATGGG
ATAGACTTAGTCCGCAAAACTGGATGAGCTTCTTCAGCGGCCTTGTTAGCGCCGGCGGTTCTCTATGGGCGCGCA
GTGGGTCGTCTGTAACGGCCAAGACGCTGACAGCAGAGGATATGAGCGAACAACTGGATGAGCTGCTGCGACAAT
CTATTTACGCCTTTACCAAGCGATGGGGCAGTTTGATGAACGACTCGCGGAGCCACAAGGCAGGGTCCAAGCCCA
TTGCCAAGCTCGAGACGGAATTGGAGGCGATATTGGATGCTGCATTCAACGGGCAGCCTGAGGTTGTATCCAAGC
TCAAGGAAGCAATTGAGCTCAATGCACAAGCACAGAGCAATGCGCAAGATGAGAAGAGGGGAGCCAAGCGATACT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail