Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4527
Gene name
LocationContig_30:22945..24696
Strand-
Gene length (bp)1751
Transcript length (bp)1701
Coding sequence length (bp)1701
Protein length (aa) 567

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 8.3E-10 206 250
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 1.1E-05 258 326
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 7.0E-09 209 269

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q05950|REB1_KLULA DNA-binding protein REB1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REB1 PE=3 SV=2 176 428 5.0E-26
sp|Q12457|NSI1_YEAST RNA polymerase I termination factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSI1 PE=1 SV=1 127 432 2.0E-25
sp|P21538|REB1_YEAST DNA-binding protein REB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REB1 PE=1 SV=2 176 305 8.0E-17
sp|Q9P6H9|REB1_SCHPO DNA-binding protein reb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=reb1 PE=3 SV=1 129 416 2.0E-15
sp|Q9UUI6|RTF_SCHPO Replication termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rtf1 PE=1 SV=2 140 365 4.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4527
MSNESSRPSLEARQDAPESMDTGEPEDAATSPRLTRSSRKRAKPTYFEQPPEVETFATENQGLEGLASSPELTPK
SRKRSKTSGSKSNRDKKRGRQSVAQSADGNLVEDAEGQSSQTPRRSHRDGFIHGRFSDQELSHISNTVISFRNEH
GMTQEEVNDMIQAPGGTTAGDAHAQLWSRIFAVCPDRHRQKVINITRKKFHNFVARGTWTQEQDAELSDLIAIHG
PKWSKIAGLINRHPEDLRDRYRNYLVCGTNQRKDAWDEMEEARLTQFVIEAMASIDDLRQSEPDREILRRSYEDL
IDWQNISERMNRTRSRLQCITKWKSLNLRTHGKDRLVSREPNSQISFRLEKARRQIQAMPDEERLRLLLAIHATS
VGKDSKIPWTRLIDKHFRNQWQRSTQILLWQRLKQTVPEWETRTTRDCAQYLVEQYNQTGTLPDLRAEGYDDALE
MELLKSKAASSTRSSGACASKEHANTKSAAIVENSDDEDDDDKNAPNSNTGEAALDAISQAVSENLPDILAETIP
EPDNMVERAVETIQDAAQHTMAQMMPVEMHDDDLKVDPALT*
Coding >OphauB2|4527
ATGAGCAACGAATCATCCAGGCCCAGCCTGGAAGCCCGACAAGACGCCCCAGAGTCCATGGACACGGGTGAGCCT
GAAGATGCAGCAACGTCGCCCAGACTGACACGGTCGAGTCGGAAAAGAGCCAAGCCGACATATTTTGAACAGCCG
CCCGAAGTGGAGACTTTTGCCACGGAGAACCAAGGCCTGGAAGGCTTGGCCTCTTCGCCAGAGCTGACACCAAAG
TCTCGCAAAAGGTCCAAGACGTCAGGGTCCAAGTCCAACAGGGATAAAAAGCGAGGCCGACAGAGCGTCGCGCAG
TCTGCCGATGGCAATCTTGTGGAGGATGCAGAGGGCCAGAGCTCGCAGACACCACGTCGAAGTCATCGCGATGGC
TTCATCCACGGCCGCTTCTCAGACCAGGAGCTATCGCACATTTCAAATACAGTCATTTCATTTAGGAACGAGCAT
GGCATGACTCAAGAAGAAGTAAATGATATGATACAGGCCCCCGGCGGAACGACAGCCGGCGATGCCCATGCTCAG
CTCTGGTCGCGCATCTTTGCAGTCTGTCCCGACCGTCACCGACAAAAGGTGATCAACATTACGCGCAAAAAATTC
CACAACTTTGTTGCGCGTGGGACGTGGACGCAGGAGCAGGACGCTGAGCTATCTGACTTGATTGCTATCCATGGC
CCCAAGTGGTCCAAGATTGCTGGCCTCATCAACCGTCATCCAGAAGACCTGCGAGACCGGTACCGCAACTACCTC
GTATGCGGCACCAACCAGCGAAAGGACGCTTGGGACGAGATGGAAGAGGCGCGGCTTACCCAATTCGTCATTGAA
GCCATGGCGTCGATTGACGACCTTCGCCAGTCGGAGCCTGACAGGGAAATCCTGCGACGGTCATATGAGGATCTA
ATAGACTGGCAGAACATTAGCGAACGAATGAACCGAACGCGCAGCCGGCTGCAGTGCATCACGAAGTGGAAGTCT
TTAAATTTGCGTACACATGGAAAGGATAGGCTGGTTTCGCGCGAGCCCAACTCGCAGATTTCATTCCGCCTGGAA
AAGGCAAGACGTCAAATACAGGCCATGCCCGACGAAGAAAGACTCCGATTACTGCTGGCCATCCACGCAACATCA
GTAGGCAAAGATTCCAAGATTCCTTGGACGCGTTTGATCGACAAGCACTTTCGCAATCAGTGGCAACGCTCCACG
CAAATTCTCTTGTGGCAACGCCTGAAGCAGACAGTGCCTGAGTGGGAGACGCGGACGACACGTGACTGCGCGCAA
TATCTGGTGGAGCAGTACAACCAAACAGGCACCCTGCCCGATCTCAGAGCTGAGGGATACGATGATGCGCTGGAA
ATGGAGCTCCTTAAATCCAAGGCAGCCTCGTCCACTCGGTCCAGCGGTGCTTGCGCCTCCAAGGAACATGCCAAC
ACCAAGAGTGCAGCCATTGTCGAGAACTCTGACGACGAGGACGATGACGACAAGAATGCACCCAACAGCAATACG
GGCGAGGCGGCCCTGGATGCCATCTCGCAGGCAGTATCGGAGAATTTGCCCGACATACTGGCCGAGACGATTCCA
GAACCTGACAACATGGTGGAGAGAGCAGTAGAGACGATTCAAGACGCTGCTCAGCATACCATGGCACAGATGATG
CCTGTTGAAATGCACGATGACGACCTCAAGGTAGATCCAGCATTGACATGA
Transcript >OphauB2|4527
ATGAGCAACGAATCATCCAGGCCCAGCCTGGAAGCCCGACAAGACGCCCCAGAGTCCATGGACACGGGTGAGCCT
GAAGATGCAGCAACGTCGCCCAGACTGACACGGTCGAGTCGGAAAAGAGCCAAGCCGACATATTTTGAACAGCCG
CCCGAAGTGGAGACTTTTGCCACGGAGAACCAAGGCCTGGAAGGCTTGGCCTCTTCGCCAGAGCTGACACCAAAG
TCTCGCAAAAGGTCCAAGACGTCAGGGTCCAAGTCCAACAGGGATAAAAAGCGAGGCCGACAGAGCGTCGCGCAG
TCTGCCGATGGCAATCTTGTGGAGGATGCAGAGGGCCAGAGCTCGCAGACACCACGTCGAAGTCATCGCGATGGC
TTCATCCACGGCCGCTTCTCAGACCAGGAGCTATCGCACATTTCAAATACAGTCATTTCATTTAGGAACGAGCAT
GGCATGACTCAAGAAGAAGTAAATGATATGATACAGGCCCCCGGCGGAACGACAGCCGGCGATGCCCATGCTCAG
CTCTGGTCGCGCATCTTTGCAGTCTGTCCCGACCGTCACCGACAAAAGGTGATCAACATTACGCGCAAAAAATTC
CACAACTTTGTTGCGCGTGGGACGTGGACGCAGGAGCAGGACGCTGAGCTATCTGACTTGATTGCTATCCATGGC
CCCAAGTGGTCCAAGATTGCTGGCCTCATCAACCGTCATCCAGAAGACCTGCGAGACCGGTACCGCAACTACCTC
GTATGCGGCACCAACCAGCGAAAGGACGCTTGGGACGAGATGGAAGAGGCGCGGCTTACCCAATTCGTCATTGAA
GCCATGGCGTCGATTGACGACCTTCGCCAGTCGGAGCCTGACAGGGAAATCCTGCGACGGTCATATGAGGATCTA
ATAGACTGGCAGAACATTAGCGAACGAATGAACCGAACGCGCAGCCGGCTGCAGTGCATCACGAAGTGGAAGTCT
TTAAATTTGCGTACACATGGAAAGGATAGGCTGGTTTCGCGCGAGCCCAACTCGCAGATTTCATTCCGCCTGGAA
AAGGCAAGACGTCAAATACAGGCCATGCCCGACGAAGAAAGACTCCGATTACTGCTGGCCATCCACGCAACATCA
GTAGGCAAAGATTCCAAGATTCCTTGGACGCGTTTGATCGACAAGCACTTTCGCAATCAGTGGCAACGCTCCACG
CAAATTCTCTTGTGGCAACGCCTGAAGCAGACAGTGCCTGAGTGGGAGACGCGGACGACACGTGACTGCGCGCAA
TATCTGGTGGAGCAGTACAACCAAACAGGCACCCTGCCCGATCTCAGAGCTGAGGGATACGATGATGCGCTGGAA
ATGGAGCTCCTTAAATCCAAGGCAGCCTCGTCCACTCGGTCCAGCGGTGCTTGCGCCTCCAAGGAACATGCCAAC
ACCAAGAGTGCAGCCATTGTCGAGAACTCTGACGACGAGGACGATGACGACAAGAATGCACCCAACAGCAATACG
GGCGAGGCGGCCCTGGATGCCATCTCGCAGGCAGTATCGGAGAATTTGCCCGACATACTGGCCGAGACGATTCCA
GAACCTGACAACATGGTGGAGAGAGCAGTAGAGACGATTCAAGACGCTGCTCAGCATACCATGGCACAGATGATG
CCTGTTGAAATGCACGATGACGACCTCAAGGTAGATCCAGCATTGACATGA
Gene >OphauB2|4527
ATGAGCAACGAATCATCCAGGCCCAGCCTGGAAGCCCGACAAGACGCCCCAGAGTCCATGGACACGGGTGAGCCT
GAAGATGCAGCAACGTCGCCCAGACTGACACGGTCGAGTCGGAAAAGAGCCAAGCCGACATATTTTGAACAGCCG
CCCGAAGTGGAGACTTTTGCCACGGAGAACCAAGGCCTGGAAGGCTTGGCCTCTTCGCCAGAGCTGACACCAAAG
TCTCGCAAAAGGTCCAAGACGTCAGGGTCCAAGTCCAACAGGGATAAAAAGCGAGGCCGACAGAGCGTCGCGCAG
TCTGCCGATGGCAATCTTGTGGAGGATGCAGAGGGCCAGAGCTCGCAGACACCACGTCGAAGTCATCGCGATGGC
TTCATCCACGGCCGCTTCTCAGACCAGGAGCTATCGCACATTTCAAATACAGTCATTTCATTTAGGAACGAGCAT
GGCATGACTCAAGAAGAAGTAAATGATGTAGGTCTGCTGAGCCCTTGTCTCAATGGCGCTCGCTGAGACTGGTGC
AGATGATACAGGCCCCCGGCGGAACGACAGCCGGCGATGCCCATGCTCAGCTCTGGTCGCGCATCTTTGCAGTCT
GTCCCGACCGTCACCGACAAAAGGTGATCAACATTACGCGCAAAAAATTCCACAACTTTGTTGCGCGTGGGACGT
GGACGCAGGAGCAGGACGCTGAGCTATCTGACTTGATTGCTATCCATGGCCCCAAGTGGTCCAAGATTGCTGGCC
TCATCAACCGTCATCCAGAAGACCTGCGAGACCGGTACCGCAACTACCTCGTATGCGGCACCAACCAGCGAAAGG
ACGCTTGGGACGAGATGGAAGAGGCGCGGCTTACCCAATTCGTCATTGAAGCCATGGCGTCGATTGACGACCTTC
GCCAGTCGGAGCCTGACAGGGAAATCCTGCGACGGTCATATGAGGATCTAATAGACTGGCAGAACATTAGCGAAC
GAATGAACCGAACGCGCAGCCGGCTGCAGTGCATCACGAAGTGGAAGTCTTTAAATTTGCGTACACATGGAAAGG
ATAGGCTGGTTTCGCGCGAGCCCAACTCGCAGATTTCATTCCGCCTGGAAAAGGCAAGACGTCAAATACAGGCCA
TGCCCGACGAAGAAAGACTCCGATTACTGCTGGCCATCCACGCAACATCAGTAGGCAAAGATTCCAAGATTCCTT
GGACGCGTTTGATCGACAAGCACTTTCGCAATCAGTGGCAACGCTCCACGCAAATTCTCTTGTGGCAACGCCTGA
AGCAGACAGTGCCTGAGTGGGAGACGCGGACGACACGTGACTGCGCGCAATATCTGGTGGAGCAGTACAACCAAA
CAGGCACCCTGCCCGATCTCAGAGCTGAGGGATACGATGATGCGCTGGAAATGGAGCTCCTTAAATCCAAGGCAG
CCTCGTCCACTCGGTCCAGCGGTGCTTGCGCCTCCAAGGAACATGCCAACACCAAGAGTGCAGCCATTGTCGAGA
ACTCTGACGACGAGGACGATGACGACAAGAATGCACCCAACAGCAATACGGGCGAGGCGGCCCTGGATGCCATCT
CGCAGGCAGTATCGGAGAATTTGCCCGACATACTGGCCGAGACGATTCCAGAACCTGACAACATGGTGGAGAGAG
CAGTAGAGACGATTCAAGACGCTGCTCAGCATACCATGGCACAGATGATGCCTGTTGAAATGCACGATGACGACC
TCAAGGTAGATCCAGCATTGACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail