Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4525
Gene name
LocationContig_30:14399..15601
Strand-
Gene length (bp)1202
Transcript length (bp)1029
Coding sequence length (bp)1029
Protein length (aa) 343

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09084 NMT1 NMT1/THI5 like 1.2E-73 16 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P42882|NMT1_ASPPA 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase OS=Aspergillus parasiticus GN=nmt1 PE=2 SV=1 1 342 0.0E+00
sp|O00057|NMT1_UROFA 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase OS=Uromyces fabae GN=PIG1 PE=2 SV=1 1 339 1.0E-164
sp|Q07748|THI13_YEAST 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI13 PE=1 SV=1 1 337 2.0E-159
sp|P43534|THI5_YEAST 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI5 PE=1 SV=1 1 337 4.0E-159
sp|P42883|THI12_YEAST 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI12 PE=3 SV=1 1 337 6.0E-159
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P42882|NMT1_ASPPA 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase OS=Aspergillus parasiticus GN=nmt1 PE=2 SV=1 1 342 0.0E+00
sp|O00057|NMT1_UROFA 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase OS=Uromyces fabae GN=PIG1 PE=2 SV=1 1 339 1.0E-164
sp|Q07748|THI13_YEAST 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI13 PE=1 SV=1 1 337 2.0E-159
sp|P43534|THI5_YEAST 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI5 PE=1 SV=1 1 337 4.0E-159
sp|P42883|THI12_YEAST 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI12 PE=3 SV=1 1 337 6.0E-159
sp|P47183|THI11_YEAST 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI11 PE=1 SV=1 1 337 4.0E-158
sp|P36597|NMT1_SCHPO 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nmt1 PE=2 SV=1 1 332 3.0E-156
sp|C4YMW2|THI5_CANAW 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase OS=Candida albicans (strain WO-1) GN=THI5 PE=1 SV=1 1 339 4.0E-154
sp|Q5A3Y5|THI5_CANAL 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=THI13 PE=1 SV=1 1 339 2.0E-152
sp|P44658|Y357_HAEIN Putative thiamine biosynthesis protein HI_0357 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0357 PE=1 SV=1 4 284 1.0E-31
sp|Q9K9G5|THIY_BACHD Formylaminopyrimidine-binding protein OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=thiY PE=1 SV=1 4 271 4.0E-13
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2040
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6835
Ophiocordyceps australis map64 (Brazil) OphauB2|4525 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01059
Ophiocordyceps camponoti-rufipedis Ophun1|6676
Ophiocordyceps kimflemingae Ophio5|5405
Ophiocordyceps subramaniannii Hirsu2|2328

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4525
MTTDKITFLTNWRATPYHAPLFLAQAKGFFSHEGIKVALLEPNDPSDVTEIIGSGKVDMGFKAMIHTLAAKARNF
PIVSVGSLLDEPFTGLVYLNGSGISNDLASLKGKRIGYVGEFGKIQIDELMSQAGLSPDDYTPLRCGMEVSQAII
RGDIDAGIGLENVQMVELEHWLASHNRPRSHVQMVRIDELARLGCCCFCSILYIANDAFVKAHPDRVASFLRAVK
RATDFVLAEPQAAWAEYIAFKPVMNTPLNRDIFERSFAYFSKDLKNVPRDWEKVTRYGQRLQVLAPDFVPNYTND
FLDWPLEPDSTDPVGDQERMVELQKDVASHGGFRRLASAVEA*
Coding >OphauB2|4525
ATGACGACCGACAAAATCACCTTTCTCACCAATTGGCGTGCCACGCCCTACCATGCTCCCCTCTTTCTGGCTCAG
GCCAAAGGCTTCTTCAGCCATGAGGGCATCAAAGTGGCCCTGCTGGAGCCAAATGACCCTAGTGACGTGACTGAA
ATCATTGGCTCTGGCAAAGTCGACATGGGCTTCAAAGCCATGATTCACACTTTGGCTGCCAAGGCACGCAACTTT
CCAATTGTCTCTGTTGGCAGCCTTCTCGACGAGCCCTTTACTGGCCTCGTTTACCTCAACGGCTCGGGTATCAGC
AACGACCTCGCCAGCCTCAAGGGCAAACGCATTGGCTACGTCGGCGAATTTGGCAAGATTCAAATTGATGAGCTC
ATGTCTCAAGCTGGTCTCTCGCCTGACGACTACACGCCCCTTCGCTGCGGCATGGAAGTCTCCCAGGCCATTATC
CGGGGCGATATTGACGCCGGCATAGGCCTTGAAAACGTGCAAATGGTGGAACTTGAGCACTGGCTGGCTTCCCAC
AATCGCCCTCGCTCCCATGTGCAAATGGTTCGCATTGATGAGCTCGCCCGTCTGGGCTGCTGCTGTTTCTGTTCC
ATTCTCTACATTGCCAATGACGCCTTTGTCAAGGCCCATCCTGACCGCGTCGCCAGCTTCTTGCGGGCTGTCAAG
CGAGCCACCGACTTTGTCCTTGCCGAGCCGCAAGCTGCCTGGGCAGAGTACATTGCCTTCAAGCCCGTCATGAAC
ACGCCCCTCAACCGCGACATTTTTGAGCGCAGCTTTGCCTACTTCTCAAAGGATCTCAAAAACGTGCCTCGTGAT
TGGGAAAAGGTCACAAGGTACGGCCAGCGCCTTCAGGTTCTGGCACCCGACTTTGTGCCAAACTATACAAACGAT
TTCCTCGACTGGCCGCTTGAGCCTGACTCGACAGACCCTGTTGGCGACCAGGAGCGCATGGTAGAGCTGCAGAAG
GACGTTGCTTCCCACGGCGGCTTCCGCAGGCTTGCTTCAGCCGTCGAGGCCTAA
Transcript >OphauB2|4525
ATGACGACCGACAAAATCACCTTTCTCACCAATTGGCGTGCCACGCCCTACCATGCTCCCCTCTTTCTGGCTCAG
GCCAAAGGCTTCTTCAGCCATGAGGGCATCAAAGTGGCCCTGCTGGAGCCAAATGACCCTAGTGACGTGACTGAA
ATCATTGGCTCTGGCAAAGTCGACATGGGCTTCAAAGCCATGATTCACACTTTGGCTGCCAAGGCACGCAACTTT
CCAATTGTCTCTGTTGGCAGCCTTCTCGACGAGCCCTTTACTGGCCTCGTTTACCTCAACGGCTCGGGTATCAGC
AACGACCTCGCCAGCCTCAAGGGCAAACGCATTGGCTACGTCGGCGAATTTGGCAAGATTCAAATTGATGAGCTC
ATGTCTCAAGCTGGTCTCTCGCCTGACGACTACACGCCCCTTCGCTGCGGCATGGAAGTCTCCCAGGCCATTATC
CGGGGCGATATTGACGCCGGCATAGGCCTTGAAAACGTGCAAATGGTGGAACTTGAGCACTGGCTGGCTTCCCAC
AATCGCCCTCGCTCCCATGTGCAAATGGTTCGCATTGATGAGCTCGCCCGTCTGGGCTGCTGCTGTTTCTGTTCC
ATTCTCTACATTGCCAATGACGCCTTTGTCAAGGCCCATCCTGACCGCGTCGCCAGCTTCTTGCGGGCTGTCAAG
CGAGCCACCGACTTTGTCCTTGCCGAGCCGCAAGCTGCCTGGGCAGAGTACATTGCCTTCAAGCCCGTCATGAAC
ACGCCCCTCAACCGCGACATTTTTGAGCGCAGCTTTGCCTACTTCTCAAAGGATCTCAAAAACGTGCCTCGTGAT
TGGGAAAAGGTCACAAGGTACGGCCAGCGCCTTCAGGTTCTGGCACCCGACTTTGTGCCAAACTATACAAACGAT
TTCCTCGACTGGCCGCTTGAGCCTGACTCGACAGACCCTGTTGGCGACCAGGAGCGCATGGTAGAGCTGCAGAAG
GACGTTGCTTCCCACGGCGGCTTCCGCAGGCTTGCTTCAGCCGTCGAGGCCTAA
Gene >OphauB2|4525
ATGACGACCGACAAAATCACCTTTCTCACCAATTGGTATGCCTCAGTCCTCGCCTCATTTTTGCAGAGGGGCCAA
TTGACCCCTGCTCAGGCGTGCCACGCCCTACCATGCTCCCCTCTTTCTGGCTCAGGCCAAAGGCTTCTTCAGCCA
TGAGGGCATCAAAGTGGCCCTGCTGGAGCCAAATGACCCTAGTGTATGCATCGTCTTGCCTCGGCCCCATGCTCC
AGCTTACCCCATTGTCTAGGACGTGACTGAAATCATTGGCTCTGGCAAAGTCGACATGGGCTTCAAAGCCATGAT
TCACACTTTGGCTGTGAGGCATCGCATACTGGCTTTGCTCTTGTCCCAAACCCTTTTATTCTAACCTCCATCTGC
TCTAGGCCAAGGCACGCAACTTTCCAATTGTCTCTGTTGGCAGCCTTCTCGACGAGCCCTTTACTGGCCTCGTTT
ACCTCAACGGCTCGGGTATCAGCAACGACCTCGCCAGCCTCAAGGGCAAACGCATTGGCTACGTCGGCGAATTTG
GCAAGATTCAAATTGATGAGCTCATGTCTCAAGCTGGTCTCTCGCCTGACGACTACACGCCCCTTCGCTGCGGCA
TGGAAGTCTCCCAGGCCATTATCCGGGGCGATATTGACGCCGGCATAGGCCTTGAAAACGTGCAAATGGTGGAAC
TTGAGCACTGGCTGGCTTCCCACAATCGCCCTCGCTCCCATGTGCAAATGGTTCGCATTGATGAGCTCGCCCGTC
TGGGCTGCTGCTGTTTCTGTTCCATTCTCTACATTGCCAATGACGCCTTTGTCAAGGCCCATCCTGACCGCGTCG
CCAGCTTCTTGCGGGCTGTCAAGCGAGCCACCGACTTTGTCCTTGCCGAGCCGCAAGCTGCCTGGGCAGAGTACA
TTGCCTTCAAGCCCGTCATGAACACGCCCCTCAACCGCGACATTTTTGAGCGCAGCTTTGCCTACTTCTCAAAGG
ATCTCAAAAACGTGCCTCGTGATTGGGAAAAGGTCACAAGGTACGGCCAGCGCCTTCAGGTTCTGGCACCCGACT
TTGTGCCAAACTATACAAACGATTTCCTCGACTGGCCGCTTGAGCCTGACTCGACAGACCCTGTTGGCGACCAGG
AGCGCATGGTAGAGCTGCAGAAGGACGTTGCTTCCCACGGCGGCTTCCGCAGGCTTGCTTCAGCCGTCGAGGCCT
AA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail