Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4522
Gene name
LocationContig_30:7557..9079
Strand-
Gene length (bp)1522
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07942 CARME Carnosine N-methyltransferase 1.1E-59 192 453

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7J3|CARME_SCHPO Carnosine N-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1778.07 PE=3 SV=1 96 452 1.0E-43
sp|F1N9S8|CARME_CHICK Carnosine N-methyltransferase OS=Gallus gallus GN=CARNMT1 PE=1 SV=2 107 409 1.0E-36
sp|Q80UY1|CARME_MOUSE Carnosine N-methyltransferase OS=Mus musculus GN=Carnmt1 PE=1 SV=1 96 453 3.0E-36
sp|Q8N4J0|CARME_HUMAN Carnosine N-methyltransferase OS=Homo sapiens GN=CARNMT1 PE=1 SV=1 107 453 5.0E-36
sp|Q5BJZ6|CARME_RAT Carnosine N-methyltransferase OS=Rattus norvegicus GN=Carnmt1 PE=1 SV=1 96 453 5.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7J3|CARME_SCHPO Carnosine N-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1778.07 PE=3 SV=1 96 452 1.0E-43
sp|F1N9S8|CARME_CHICK Carnosine N-methyltransferase OS=Gallus gallus GN=CARNMT1 PE=1 SV=2 107 409 1.0E-36
sp|Q80UY1|CARME_MOUSE Carnosine N-methyltransferase OS=Mus musculus GN=Carnmt1 PE=1 SV=1 96 453 3.0E-36
sp|Q8N4J0|CARME_HUMAN Carnosine N-methyltransferase OS=Homo sapiens GN=CARNMT1 PE=1 SV=1 107 453 5.0E-36
sp|Q5BJZ6|CARME_RAT Carnosine N-methyltransferase OS=Rattus norvegicus GN=Carnmt1 PE=1 SV=1 96 453 5.0E-36
sp|Q9I7X6|CARME_DROME Carnosine N-methyltransferase OS=Drosophila melanogaster GN=CG11596 PE=1 SV=1 195 453 8.0E-30
sp|Q54ST2|CARME_DICDI Carnosine N-methyltransferase OS=Dictyostelium discoideum GN=DDB_G0282239 PE=3 SV=1 127 451 1.0E-25
sp|P53934|CARME_YEAST Carnosine N-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL092W PE=1 SV=1 109 384 2.0E-25
sp|Q03648|YM59_YEAST Uncharacterized protein YMR209C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR209C PE=1 SV=1 195 419 2.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008168 methyltransferase activity No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4522
MRPPQLMAMMKFIVRRVAAWCWLAGLLPGPSWAHHGTETAAHQDTMSQVVPGVFTEVHQLLVTLQQNQSQLVSLR
HKEEKARLMASLDQSKGPWTETHARYRLLSALHAFTRYEERQRAELARLRKLHKGVSKAQKAFLDHHVAYWAKFD
RVEQRLTANQQLCNDIVSTALDFYRLDRSELQSFIHDSEAQGHVADKTAVSQALKHIVRDWTQEGRHERHLPFAC
MLDTVDSLFPARQAAEPLRALLPGAGLGRLGHQLDRLGGFQVTINEWSMFMNVVYRFLDTHGLQDQHSLYPFVDG
WSHHATDADMLRKLSFPDDTLDPRSVLLVEGDFTTVFAHQHGHYHLVLTYFFIDTARNLMSYLDTIKKLLKSGGY
WLNLGPLLYGTAPFVQLSLEDIITITKAMGFEFDHTDDKYGPLTFQGSTVRSIEAIYGFDNKALTKNSYNAQFWV
AKKL*
Coding >OphauB2|4522
ATGCGTCCTCCTCAGCTCATGGCCATGATGAAGTTTATAGTGCGTCGAGTGGCTGCCTGGTGCTGGCTCGCAGGC
CTTTTGCCCGGGCCGTCTTGGGCCCATCATGGCACCGAGACGGCGGCGCATCAAGACACCATGTCCCAGGTGGTG
CCGGGAGTCTTTACCGAGGTGCACCAGCTGCTGGTGACGCTGCAGCAGAACCAGAGCCAGCTGGTGAGCCTGCGG
CACAAGGAGGAAAAGGCCCGGCTCATGGCGTCGCTTGACCAATCCAAGGGCCCGTGGACCGAGACTCATGCGCGC
TACAGACTGCTCAGTGCGCTGCATGCCTTTACCCGGTACGAGGAGCGCCAGAGGGCCGAGCTGGCTCGTCTGCGC
AAACTGCACAAGGGCGTGTCCAAGGCGCAAAAGGCTTTTCTCGACCATCACGTGGCCTACTGGGCCAAGTTTGAC
CGCGTCGAGCAAAGACTAACGGCCAACCAGCAGCTGTGCAACGACATTGTCAGCACCGCCCTCGACTTTTACCGC
CTCGACAGGAGCGAGCTGCAGAGCTTCATCCACGACTCTGAGGCGCAGGGCCATGTCGCCGACAAGACGGCCGTG
TCGCAGGCGCTCAAGCACATTGTCAGAGACTGGACCCAAGAGGGCCGCCACGAGCGCCATTTGCCCTTTGCCTGC
ATGCTCGACACTGTCGACAGCCTGTTTCCCGCCCGACAAGCTGCTGAGCCCCTCCGCGCCTTGCTGCCGGGAGCT
GGCCTGGGAAGGCTGGGCCACCAGCTGGACCGTCTGGGTGGCTTCCAAGTCACCATCAACGAGTGGTCCATGTTT
ATGAATGTCGTCTACCGCTTCCTCGACACCCACGGGCTCCAGGACCAACACTCCTTGTACCCCTTTGTCGACGGC
TGGTCTCACCATGCCACCGACGCAGACATGCTTCGCAAGCTCTCCTTTCCCGACGATACCCTCGACCCCCGCTCC
GTACTGCTTGTCGAGGGAGACTTCACCACTGTTTTTGCCCACCAACACGGCCACTACCACCTGGTGCTCACCTAC
TTCTTCATCGACACGGCACGAAACCTCATGAGCTACCTTGACACCATCAAGAAGCTGCTCAAGAGCGGCGGCTAC
TGGCTCAATCTCGGGCCTCTGCTCTACGGCACCGCCCCCTTTGTCCAGCTCTCACTCGAGGACATCATCACCATC
ACCAAAGCCATGGGCTTTGAGTTTGACCACACGGACGACAAGTACGGGCCCCTCACCTTTCAAGGCTCCACCGTC
AGGAGCATCGAGGCCATTTACGGCTTTGACAACAAGGCCTTGACCAAGAACTCGTACAATGCACAGTTTTGGGTA
GCCAAGAAATTATAA
Transcript >OphauB2|4522
ATGCGTCCTCCTCAGCTCATGGCCATGATGAAGTTTATAGTGCGTCGAGTGGCTGCCTGGTGCTGGCTCGCAGGC
CTTTTGCCCGGGCCGTCTTGGGCCCATCATGGCACCGAGACGGCGGCGCATCAAGACACCATGTCCCAGGTGGTG
CCGGGAGTCTTTACCGAGGTGCACCAGCTGCTGGTGACGCTGCAGCAGAACCAGAGCCAGCTGGTGAGCCTGCGG
CACAAGGAGGAAAAGGCCCGGCTCATGGCGTCGCTTGACCAATCCAAGGGCCCGTGGACCGAGACTCATGCGCGC
TACAGACTGCTCAGTGCGCTGCATGCCTTTACCCGGTACGAGGAGCGCCAGAGGGCCGAGCTGGCTCGTCTGCGC
AAACTGCACAAGGGCGTGTCCAAGGCGCAAAAGGCTTTTCTCGACCATCACGTGGCCTACTGGGCCAAGTTTGAC
CGCGTCGAGCAAAGACTAACGGCCAACCAGCAGCTGTGCAACGACATTGTCAGCACCGCCCTCGACTTTTACCGC
CTCGACAGGAGCGAGCTGCAGAGCTTCATCCACGACTCTGAGGCGCAGGGCCATGTCGCCGACAAGACGGCCGTG
TCGCAGGCGCTCAAGCACATTGTCAGAGACTGGACCCAAGAGGGCCGCCACGAGCGCCATTTGCCCTTTGCCTGC
ATGCTCGACACTGTCGACAGCCTGTTTCCCGCCCGACAAGCTGCTGAGCCCCTCCGCGCCTTGCTGCCGGGAGCT
GGCCTGGGAAGGCTGGGCCACCAGCTGGACCGTCTGGGTGGCTTCCAAGTCACCATCAACGAGTGGTCCATGTTT
ATGAATGTCGTCTACCGCTTCCTCGACACCCACGGGCTCCAGGACCAACACTCCTTGTACCCCTTTGTCGACGGC
TGGTCTCACCATGCCACCGACGCAGACATGCTTCGCAAGCTCTCCTTTCCCGACGATACCCTCGACCCCCGCTCC
GTACTGCTTGTCGAGGGAGACTTCACCACTGTTTTTGCCCACCAACACGGCCACTACCACCTGGTGCTCACCTAC
TTCTTCATCGACACGGCACGAAACCTCATGAGCTACCTTGACACCATCAAGAAGCTGCTCAAGAGCGGCGGCTAC
TGGCTCAATCTCGGGCCTCTGCTCTACGGCACCGCCCCCTTTGTCCAGCTCTCACTCGAGGACATCATCACCATC
ACCAAAGCCATGGGCTTTGAGTTTGACCACACGGACGACAAGTACGGGCCCCTCACCTTTCAAGGCTCCACCGTC
AGGAGCATCGAGGCCATTTACGGCTTTGACAACAAGGCCTTGACCAAGAACTCGTACAATGCACAGTTTTGGGTA
GCCAAGAAATTATAA
Gene >OphauB2|4522
ATGCGTCCTCCTCAGCTCATGGCCATGATGAAGTTTATAGTGCGTCGAGTGGCTGCCTGGTGCTGGCTCGCAGGC
CTTTTGCCCGGGCCGTCTTGGGCCCATCATGGCACCGAGACGGCGGCGCATCAAGACACCATGTCCCAGGTGGTG
CCGGGAGTCTTTACCGAGGTGCACCAGCTGCTGGTGACGCTGCAGCAGAACCAGAGCCAGCTGGTGAGCCTGCGG
CACAAGGAGGAAAAGGCCCGGCTCATGGCGTCGCTTGACCAATCCAAGGGCCCGTGGACCGAGACTCATGCGCGC
TACAGACTGCTCAGTGCGCTGCATGCCTTTACCCGGTACGAGGAGCGCCAGAGGGCCGAGCTGGCTCGTCTGCGC
AAACTGCACAAGGGCGTGTCCAAGGCGCAAAAGGCTGTAAGGAGCTGCCGCCACCTTGGACCTTGGCGCCGGAGC
GGCCCTGGGGACTGACTTTGGGACTGACTTTGCGACTGACTTGCACCCGCCAGTTTCTCGACCATCACGTGGCCT
ACTGGGCCAAGTTTGACCGCGTCGAGCAAAGACTAACGGCCAACCAGCAGCTGTGCAACGACATTGTCAGCACCG
CCCTCGACTTTTACCGCCTCGACAGGAGCGAGCTGCAGAGCTTCATCCACGACTCTGAGGCGCAGGGCCATGTCG
CCGACAAGACGGCCGTGTCGCAGGCGCTCAAGCACATTGTCAGAGACTGGACCCAAGAGGGCCGCCACGAGCGCC
ATTTGCCCTTTGCCTGCATGCTCGACACTGTCGACAGCCTGTTTCCCGCCCGACAAGCTGCTGAGCCCCTCCGCG
CCTTGCTGCCGGGAGCTGGCCTGGGAAGGCTGGGCCACCAGCTGGACCGTCTGGGTGGTAACTCGCCCCCTCCCC
TTTATCCTGGCCCAAGACTGACACGGCCATGCTCACGCCGTGCACAGGCTTCCAAGTCACCATCAACGAGTGGTC
CATGTTTATGAATGTCGTCTACCGCTTCCTCGACACCCACGGGCTCCAGGACCAACACTCCTTGTACCCCTTTGT
CGACGGCTGGTCTCACCATGCCACCGACGCAGACATGCTTCGCAAGCTCTCCTTTCCCGACGATACCCTCGACCC
CCGCTCCGTACTGCTTGTCGAGGGAGACTTCACCACTGTTTTTGCCCACCAACACGGCCACTACCACCTGGTGCT
CACCTACTTCTTCATCGACACGGCACGAAACCTCATGAGCTACCTTGACACCATCAAGAAGCTGCTCAAGAGCGG
CGGCTACTGGCTCAATCTCGGGCCTCTGCTCTACGGCACCGCCCCCTTTGTCCAGCTCTCACTCGAGGACATCAT
CACCATCACCAAAGCCATGGGCTTTGAGTTTGACCACACGGACGACAAGTACGGGCCCCTCACCTTTCAAGGCTC
CACCGTCAGGAGCATCGAGGCCATTTACGGCTTTGACAACAAGGCCTTGACCAAGAACTCGTACAATGCACAGTT
TTGGGTAGCCAAGAAATTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail