Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4514
Gene name
LocationContig_3:357736..363120
Strand+
Gene length (bp)5384
Transcript length (bp)5190
Coding sequence length (bp)5190
Protein length (aa) 1730

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12231 Rif1_N Rap1-interacting factor 1 N terminal 9.8E-124 157 532

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q96UP3|RIF1_SCHPO Telomere length regulator protein rif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rif1 PE=1 SV=1 76 645 2.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4514
MASCAAPASNLLASLPARPPTPPRETNHNADAASLLRSLAFNRSQAFDPRHSFQTPPSTISPVSSSANSISSSRR
RRKKVEWSNHTQYKDPPEYLNGSRLTPPCPISVPPSASLQPIKGILKPSSPLHLGSSENSSLHGVFPQLDLLEML
ESTIKQLAGSDRDSKLDAYMMLSRALKASDNLPDRVALRNKMTLFMQFIQRDVVARNEDGSLDASLINHALVLLV
TLLHYQAIASTLTYDFGVFMLDHAIRCFQDSSTPKDIVGHVMQIVAFQDFSIKVMTADRVGRLVGALHNIERHVQ
GKSIVCGRLLVYNKLVKQARSNIIIHSDWLKDMFNDMLSSIKDIRAKAISLGTEAGFALRSDRRLFRKVAEIFEA
RNGDQEKDESYIEFYIKRLRAMLEERQTSHAVPQILAVVILFMRCPLNEWKLYSQWLTLVQAAFNKADLQTKQEA
NFAWNCYAYLSIMDSKPSPKMLTRLCQPLLAQLKRKANPKQMEAALRLRDVVVGGLCNLYSHVLAQRDNQQFADD
MVWDVVVQPALSQLIVLESTPDVPKGCTAILCRILTGVLDTSRRLRRSLDSNLNLTPLTPEELMPIDSKWVRRNC
DKVYQVAGPILESNLIDLADEQSQTLKLWKAFVGAIAMASAKDIKFVNVLVQSLGLLPFTEKKLCMNGPNTFQTV
VTPSRRAGKNSDSRAASRIPLHHLFLMLSSNCRGIDDEEALASMFISIFQPFFENRDTTNRKELARELIHLVPRN
CLSPFGPWVLAAENMKPWLDQMNADNGSLPPSSNTFLGPDFREVVALLERGLMCHPNLPVRHWRPLFDSISTAVA
QGYGDAGRVLILVEPLAKVLLDGAVHDSDQPSNLSLSAMAMLFSVAKLPRDRQALDAARQRLWGAAKGRHGPFDP
LCNLYKLGNQGLKRLYHLGSDTELIADVASVMDAAITFLDKCLPQASIKVISDLQNGICLWIEDEEEKVPQDKSQ
DITKTIYRFWDHICQKITSCDQLERQDVDQIEPVLTAAFKSKHAYVRDKATDVWNALGEGNKEIDCSDSLKSILS
SLHTKSIHGLQSADSSAAGFGAQTSLFADAPDDDALIAPASEASTRDASEATDDKDRVPEPSSSKKRRRETPTGS
HEKPGKKTRAARPRHQDSQIFFVAIPAGASTANESQHLTENQMDVRQRQREQALLYSDMGTSSPQDVAEETTKTG
KHEQVGSGQSPAVETTPRKERSFDDLISSTPTPRRGQTLPVIDMNDPPSSPPVPRPYPLLSEIQSRSRSSADINS
WEFSSPTTSPITKHQRAPERSASVTSNQDFKFAKENEEQQAVHEAHIHAAEPHNNGGAHDEAVDMDMSPKEAAPV
STKPDVTSAQYLHLSNHQTQESTNLVDDDLDEEFVDARSNPALSSPISRSVAADKSGAEKEIKVASFEISEIEED
HFEHLLTEVEARCKLQGASRAQHESEGDEDPTESQIVVATEELPLARCSKRERYTPSPSKGSGRTRRQKWTSPVS
PRTPTKVTGQDEGSGSKHKRKRGEKRHHDVRSSKRRRSITSVSNQSAEGKTGSLGPELSPCARKAPAKAVRRSLR
HRKQSATDVQDLDAASSPASKASDRDKSNEYEGPEQGDTDEEVLSQLVTESAAASQQSHNSQPAPLGVVTRAQTL
AGASVAGINKSAPADEERARDGKTGIIKTLRSGLDQLRKAALGREAVYELEDVLMDIKRELYEAELRGRRKGGSF
AIIH*
Coding >OphauB2|4514
ATGGCATCTTGTGCAGCCCCGGCCTCAAACCTTTTGGCTTCTCTTCCTGCTCGGCCGCCAACTCCTCCACGCGAA
ACCAATCACAACGCCGATGCTGCCTCTCTGCTTCGGTCTCTGGCGTTCAACCGCTCCCAGGCTTTCGACCCCCGC
CACAGCTTTCAGACGCCCCCAAGTACCATCTCGCCCGTCTCATCTTCTGCCAATTCCATCTCGAGCTCGCGTCGT
CGCCGCAAAAAGGTGGAGTGGTCCAATCATACTCAATACAAGGATCCTCCTGAGTATCTCAACGGCTCTCGTCTC
ACTCCTCCTTGCCCGATTTCCGTTCCACCGTCAGCCTCGTTGCAACCCATAAAAGGCATTCTCAAGCCCTCCTCT
CCGCTTCATCTTGGCTCCTCTGAGAACAGCAGCTTGCATGGCGTTTTTCCTCAGCTTGATCTCCTCGAAATGCTC
GAATCTACCATAAAGCAGCTCGCCGGCTCGGACCGGGACTCGAAACTCGACGCCTATATGATGCTTAGCAGGGCC
CTCAAAGCCTCCGACAACCTGCCTGATCGTGTTGCCCTCCGGAATAAGATGACACTATTCATGCAATTCATCCAG
CGCGATGTTGTAGCCAGGAATGAAGATGGCTCTCTCGACGCATCTCTTATCAACCACGCTCTCGTTTTGCTTGTC
ACCTTGCTCCATTACCAGGCCATAGCGTCTACCCTGACTTATGATTTTGGTGTCTTCATGCTAGACCATGCCATA
CGATGCTTTCAGGACTCTTCTACTCCCAAGGACATCGTTGGACATGTGATGCAGATTGTTGCATTTCAGGATTTC
TCTATCAAGGTCATGACGGCGGATCGTGTCGGCCGGCTTGTTGGCGCCCTACACAATATTGAGCGTCATGTTCAA
GGAAAAAGCATTGTGTGTGGGCGACTCCTCGTCTACAACAAACTGGTCAAGCAAGCTCGAAGCAATATCATCATT
CACTCGGACTGGCTCAAAGACATGTTCAACGACATGTTGAGCAGCATCAAAGATATCCGTGCCAAAGCCATATCC
CTGGGAACTGAGGCAGGATTTGCTCTTCGTTCTGATAGACGCTTGTTCCGCAAAGTCGCAGAGATTTTCGAGGCA
AGAAACGGTGACCAAGAGAAAGATGAGAGCTACATCGAGTTCTACATCAAGCGGCTCAGGGCCATGCTGGAGGAG
AGACAAACTAGTCATGCTGTTCCTCAGATCTTGGCTGTCGTCATTCTCTTCATGCGCTGTCCTCTCAATGAGTGG
AAGCTTTATAGCCAGTGGCTCACTCTAGTCCAGGCAGCATTCAACAAGGCCGATCTCCAGACCAAGCAAGAAGCA
AACTTCGCTTGGAATTGCTATGCATATCTGTCCATCATGGATAGCAAACCGTCGCCCAAGATGCTCACGAGGCTA
TGTCAACCTCTTCTGGCCCAGCTAAAAAGAAAGGCCAACCCCAAGCAAATGGAAGCGGCTCTGAGATTGCGCGAT
GTTGTTGTGGGGGGCTTGTGCAACTTGTACAGTCACGTCCTGGCGCAACGAGATAATCAACAATTCGCAGATGAC
ATGGTCTGGGATGTCGTGGTGCAGCCAGCCTTGTCCCAACTAATTGTTCTAGAGAGCACACCAGATGTTCCCAAA
GGCTGCACGGCAATTTTGTGTCGCATCCTCACCGGCGTTCTGGATACCTCGCGTCGCTTGCGTCGAAGCCTTGAT
AGCAACCTTAACTTGACACCACTAACTCCTGAGGAGCTGATGCCAATAGATTCAAAATGGGTTCGAAGAAACTGT
GACAAAGTCTATCAAGTGGCAGGTCCAATTCTCGAAAGCAACCTTATAGACTTGGCGGACGAACAGAGCCAAACA
TTGAAACTCTGGAAAGCTTTTGTCGGAGCCATAGCCATGGCATCTGCCAAAGATATCAAATTTGTCAATGTCTTG
GTTCAATCTCTTGGTCTGTTACCATTTACTGAGAAGAAGCTCTGCATGAACGGACCCAATACCTTTCAAACAGTC
GTCACACCGTCACGGCGAGCAGGCAAGAATTCAGACTCTCGGGCTGCGTCGCGCATACCGTTGCATCACTTGTTT
CTCATGCTGTCGTCAAATTGTCGAGGGATTGATGATGAAGAAGCACTGGCCAGTATGTTCATCTCGATTTTTCAG
CCGTTCTTCGAGAATCGCGACACCACCAACCGCAAGGAGCTGGCTCGGGAATTGATTCATCTTGTGCCGCGAAAT
TGCCTCTCTCCTTTTGGACCCTGGGTTCTTGCGGCAGAGAATATGAAACCCTGGCTGGATCAAATGAATGCCGAT
AACGGATCGCTTCCCCCAAGTAGCAATACATTCTTGGGTCCAGACTTTCGAGAAGTAGTGGCTCTTCTTGAGCGT
GGCCTAATGTGCCATCCCAATTTGCCCGTCAGACATTGGAGGCCACTGTTTGATTCTATTTCAACCGCAGTGGCA
CAAGGATACGGCGACGCTGGCCGTGTTCTGATACTTGTGGAGCCGCTGGCCAAAGTGTTGCTTGACGGCGCCGTT
CATGACTCTGACCAGCCGTCAAACCTGTCTCTCTCGGCAATGGCGATGTTATTCTCTGTTGCCAAGCTTCCGCGT
GATCGACAAGCGCTTGACGCCGCCCGCCAGCGCCTTTGGGGAGCAGCCAAGGGCAGACACGGCCCTTTCGATCCC
TTGTGCAACCTCTACAAGCTTGGGAATCAAGGTTTGAAGAGGCTCTATCACCTTGGCTCCGACACAGAGTTGATT
GCAGATGTGGCCTCGGTAATGGATGCCGCAATTACCTTCTTGGACAAGTGTCTGCCTCAAGCTTCTATCAAGGTC
ATTTCCGACCTGCAAAATGGTATTTGCCTATGGATAGAAGACGAAGAGGAAAAGGTTCCGCAAGACAAGTCACAA
GACATTACCAAAACTATCTATCGCTTCTGGGATCACATCTGTCAAAAGATTACGTCTTGTGATCAGCTTGAAAGA
CAAGACGTGGACCAGATTGAGCCCGTCTTGACGGCTGCTTTCAAGAGTAAGCATGCCTACGTCCGTGACAAAGCC
ACAGATGTTTGGAATGCGCTTGGCGAGGGGAACAAAGAAATAGACTGCTCAGATAGCCTCAAGTCTATTCTTTCC
TCTCTGCATACCAAGAGCATTCACGGCTTGCAGAGTGCTGACTCGTCAGCTGCTGGCTTCGGTGCACAGACATCT
TTGTTTGCCGATGCTCCGGATGACGATGCTCTTATTGCACCCGCATCAGAGGCTTCAACTCGTGACGCTTCTGAA
GCTACGGATGACAAAGATCGGGTACCCGAGCCATCAAGTTCGAAGAAACGGCGTCGCGAAACGCCTACAGGGAGC
CATGAAAAACCGGGCAAGAAGACGAGAGCCGCACGACCTCGCCATCAAGACTCGCAGATTTTCTTCGTGGCTATT
CCTGCTGGTGCTTCCACTGCCAATGAATCTCAACATCTGACGGAGAATCAGATGGATGTTCGCCAAAGGCAAAGA
GAGCAGGCTCTCTTGTACTCAGACATGGGCACCTCTTCTCCGCAAGACGTCGCGGAGGAAACCACGAAAACGGGC
AAGCATGAACAAGTCGGCAGTGGTCAAAGTCCTGCCGTGGAGACTACTCCGAGGAAGGAGAGATCATTTGACGAT
TTGATCTCTTCGACGCCCACGCCGAGACGAGGGCAAACTCTGCCTGTCATAGATATGAACGACCCCCCTTCCTCG
CCCCCAGTTCCTCGGCCATACCCACTCCTGTCAGAAATTCAATCACGATCAAGAAGCAGTGCGGATATCAACAGC
TGGGAATTCTCGTCACCAACCACTTCTCCCATTACAAAGCATCAAAGAGCTCCTGAGAGGAGCGCTTCTGTCACA
TCCAATCAAGATTTTAAGTTTGCAAAAGAAAATGAGGAACAGCAAGCTGTGCATGAAGCGCATATACATGCGGCC
GAACCTCATAATAATGGTGGTGCTCATGACGAGGCTGTGGACATGGATATGTCACCCAAAGAGGCAGCTCCAGTC
TCTACAAAGCCTGATGTCACGTCAGCTCAATATCTACATTTATCCAACCATCAGACGCAAGAATCAACAAACTTG
GTCGATGACGACTTGGACGAGGAATTTGTGGATGCTAGAAGCAATCCAGCTCTATCATCACCTATTTCGAGGAGT
GTTGCAGCCGACAAAAGCGGTGCTGAGAAGGAAATCAAAGTAGCTTCATTTGAAATTAGCGAAATTGAGGAGGAT
CATTTCGAGCATTTGCTTACTGAAGTGGAGGCGCGATGCAAACTGCAAGGCGCGTCTAGAGCACAGCACGAGAGC
GAGGGAGATGAGGACCCAACCGAGTCACAGATTGTGGTGGCGACTGAGGAACTCCCTCTGGCTAGATGCAGCAAG
CGCGAGCGATACACGCCATCACCAAGCAAAGGGTCTGGACGGACAAGGCGCCAGAAATGGACATCTCCGGTCTCC
CCAAGGACGCCGACCAAGGTCACTGGTCAGGACGAGGGATCCGGAAGTAAGCACAAGAGAAAACGGGGCGAGAAG
CGGCATCATGACGTTCGGTCAAGCAAGAGAAGGCGGTCCATAACGTCAGTCTCAAACCAGTCAGCCGAGGGCAAG
ACTGGCTCTCTGGGGCCCGAGTTGAGCCCGTGCGCTCGCAAAGCACCGGCCAAGGCGGTACGAAGAAGTTTGCGT
CACCGGAAACAATCAGCAACAGATGTGCAAGACTTAGATGCCGCATCTTCTCCAGCAAGCAAAGCCTCTGACCGC
GACAAGTCAAATGAGTATGAAGGGCCAGAGCAGGGCGACACTGACGAGGAAGTCTTGTCCCAGCTGGTTACGGAA
TCCGCTGCAGCCTCACAGCAGAGCCACAACTCGCAACCAGCCCCATTGGGAGTGGTAACGAGGGCTCAAACACTG
GCAGGTGCTTCAGTGGCAGGGATCAATAAATCGGCACCAGCTGACGAGGAGAGAGCCCGGGATGGCAAGACGGGC
ATTATTAAGACTCTGCGGAGTGGACTAGATCAGCTACGCAAGGCAGCTCTTGGGAGAGAGGCGGTGTATGAGTTG
GAAGACGTGCTCATGGATATCAAGCGCGAACTATACGAGGCGGAGCTGAGGGGAAGAAGAAAGGGAGGCAGTTTT
GCTATTATTCATTAG
Transcript >OphauB2|4514
ATGGCATCTTGTGCAGCCCCGGCCTCAAACCTTTTGGCTTCTCTTCCTGCTCGGCCGCCAACTCCTCCACGCGAA
ACCAATCACAACGCCGATGCTGCCTCTCTGCTTCGGTCTCTGGCGTTCAACCGCTCCCAGGCTTTCGACCCCCGC
CACAGCTTTCAGACGCCCCCAAGTACCATCTCGCCCGTCTCATCTTCTGCCAATTCCATCTCGAGCTCGCGTCGT
CGCCGCAAAAAGGTGGAGTGGTCCAATCATACTCAATACAAGGATCCTCCTGAGTATCTCAACGGCTCTCGTCTC
ACTCCTCCTTGCCCGATTTCCGTTCCACCGTCAGCCTCGTTGCAACCCATAAAAGGCATTCTCAAGCCCTCCTCT
CCGCTTCATCTTGGCTCCTCTGAGAACAGCAGCTTGCATGGCGTTTTTCCTCAGCTTGATCTCCTCGAAATGCTC
GAATCTACCATAAAGCAGCTCGCCGGCTCGGACCGGGACTCGAAACTCGACGCCTATATGATGCTTAGCAGGGCC
CTCAAAGCCTCCGACAACCTGCCTGATCGTGTTGCCCTCCGGAATAAGATGACACTATTCATGCAATTCATCCAG
CGCGATGTTGTAGCCAGGAATGAAGATGGCTCTCTCGACGCATCTCTTATCAACCACGCTCTCGTTTTGCTTGTC
ACCTTGCTCCATTACCAGGCCATAGCGTCTACCCTGACTTATGATTTTGGTGTCTTCATGCTAGACCATGCCATA
CGATGCTTTCAGGACTCTTCTACTCCCAAGGACATCGTTGGACATGTGATGCAGATTGTTGCATTTCAGGATTTC
TCTATCAAGGTCATGACGGCGGATCGTGTCGGCCGGCTTGTTGGCGCCCTACACAATATTGAGCGTCATGTTCAA
GGAAAAAGCATTGTGTGTGGGCGACTCCTCGTCTACAACAAACTGGTCAAGCAAGCTCGAAGCAATATCATCATT
CACTCGGACTGGCTCAAAGACATGTTCAACGACATGTTGAGCAGCATCAAAGATATCCGTGCCAAAGCCATATCC
CTGGGAACTGAGGCAGGATTTGCTCTTCGTTCTGATAGACGCTTGTTCCGCAAAGTCGCAGAGATTTTCGAGGCA
AGAAACGGTGACCAAGAGAAAGATGAGAGCTACATCGAGTTCTACATCAAGCGGCTCAGGGCCATGCTGGAGGAG
AGACAAACTAGTCATGCTGTTCCTCAGATCTTGGCTGTCGTCATTCTCTTCATGCGCTGTCCTCTCAATGAGTGG
AAGCTTTATAGCCAGTGGCTCACTCTAGTCCAGGCAGCATTCAACAAGGCCGATCTCCAGACCAAGCAAGAAGCA
AACTTCGCTTGGAATTGCTATGCATATCTGTCCATCATGGATAGCAAACCGTCGCCCAAGATGCTCACGAGGCTA
TGTCAACCTCTTCTGGCCCAGCTAAAAAGAAAGGCCAACCCCAAGCAAATGGAAGCGGCTCTGAGATTGCGCGAT
GTTGTTGTGGGGGGCTTGTGCAACTTGTACAGTCACGTCCTGGCGCAACGAGATAATCAACAATTCGCAGATGAC
ATGGTCTGGGATGTCGTGGTGCAGCCAGCCTTGTCCCAACTAATTGTTCTAGAGAGCACACCAGATGTTCCCAAA
GGCTGCACGGCAATTTTGTGTCGCATCCTCACCGGCGTTCTGGATACCTCGCGTCGCTTGCGTCGAAGCCTTGAT
AGCAACCTTAACTTGACACCACTAACTCCTGAGGAGCTGATGCCAATAGATTCAAAATGGGTTCGAAGAAACTGT
GACAAAGTCTATCAAGTGGCAGGTCCAATTCTCGAAAGCAACCTTATAGACTTGGCGGACGAACAGAGCCAAACA
TTGAAACTCTGGAAAGCTTTTGTCGGAGCCATAGCCATGGCATCTGCCAAAGATATCAAATTTGTCAATGTCTTG
GTTCAATCTCTTGGTCTGTTACCATTTACTGAGAAGAAGCTCTGCATGAACGGACCCAATACCTTTCAAACAGTC
GTCACACCGTCACGGCGAGCAGGCAAGAATTCAGACTCTCGGGCTGCGTCGCGCATACCGTTGCATCACTTGTTT
CTCATGCTGTCGTCAAATTGTCGAGGGATTGATGATGAAGAAGCACTGGCCAGTATGTTCATCTCGATTTTTCAG
CCGTTCTTCGAGAATCGCGACACCACCAACCGCAAGGAGCTGGCTCGGGAATTGATTCATCTTGTGCCGCGAAAT
TGCCTCTCTCCTTTTGGACCCTGGGTTCTTGCGGCAGAGAATATGAAACCCTGGCTGGATCAAATGAATGCCGAT
AACGGATCGCTTCCCCCAAGTAGCAATACATTCTTGGGTCCAGACTTTCGAGAAGTAGTGGCTCTTCTTGAGCGT
GGCCTAATGTGCCATCCCAATTTGCCCGTCAGACATTGGAGGCCACTGTTTGATTCTATTTCAACCGCAGTGGCA
CAAGGATACGGCGACGCTGGCCGTGTTCTGATACTTGTGGAGCCGCTGGCCAAAGTGTTGCTTGACGGCGCCGTT
CATGACTCTGACCAGCCGTCAAACCTGTCTCTCTCGGCAATGGCGATGTTATTCTCTGTTGCCAAGCTTCCGCGT
GATCGACAAGCGCTTGACGCCGCCCGCCAGCGCCTTTGGGGAGCAGCCAAGGGCAGACACGGCCCTTTCGATCCC
TTGTGCAACCTCTACAAGCTTGGGAATCAAGGTTTGAAGAGGCTCTATCACCTTGGCTCCGACACAGAGTTGATT
GCAGATGTGGCCTCGGTAATGGATGCCGCAATTACCTTCTTGGACAAGTGTCTGCCTCAAGCTTCTATCAAGGTC
ATTTCCGACCTGCAAAATGGTATTTGCCTATGGATAGAAGACGAAGAGGAAAAGGTTCCGCAAGACAAGTCACAA
GACATTACCAAAACTATCTATCGCTTCTGGGATCACATCTGTCAAAAGATTACGTCTTGTGATCAGCTTGAAAGA
CAAGACGTGGACCAGATTGAGCCCGTCTTGACGGCTGCTTTCAAGAGTAAGCATGCCTACGTCCGTGACAAAGCC
ACAGATGTTTGGAATGCGCTTGGCGAGGGGAACAAAGAAATAGACTGCTCAGATAGCCTCAAGTCTATTCTTTCC
TCTCTGCATACCAAGAGCATTCACGGCTTGCAGAGTGCTGACTCGTCAGCTGCTGGCTTCGGTGCACAGACATCT
TTGTTTGCCGATGCTCCGGATGACGATGCTCTTATTGCACCCGCATCAGAGGCTTCAACTCGTGACGCTTCTGAA
GCTACGGATGACAAAGATCGGGTACCCGAGCCATCAAGTTCGAAGAAACGGCGTCGCGAAACGCCTACAGGGAGC
CATGAAAAACCGGGCAAGAAGACGAGAGCCGCACGACCTCGCCATCAAGACTCGCAGATTTTCTTCGTGGCTATT
CCTGCTGGTGCTTCCACTGCCAATGAATCTCAACATCTGACGGAGAATCAGATGGATGTTCGCCAAAGGCAAAGA
GAGCAGGCTCTCTTGTACTCAGACATGGGCACCTCTTCTCCGCAAGACGTCGCGGAGGAAACCACGAAAACGGGC
AAGCATGAACAAGTCGGCAGTGGTCAAAGTCCTGCCGTGGAGACTACTCCGAGGAAGGAGAGATCATTTGACGAT
TTGATCTCTTCGACGCCCACGCCGAGACGAGGGCAAACTCTGCCTGTCATAGATATGAACGACCCCCCTTCCTCG
CCCCCAGTTCCTCGGCCATACCCACTCCTGTCAGAAATTCAATCACGATCAAGAAGCAGTGCGGATATCAACAGC
TGGGAATTCTCGTCACCAACCACTTCTCCCATTACAAAGCATCAAAGAGCTCCTGAGAGGAGCGCTTCTGTCACA
TCCAATCAAGATTTTAAGTTTGCAAAAGAAAATGAGGAACAGCAAGCTGTGCATGAAGCGCATATACATGCGGCC
GAACCTCATAATAATGGTGGTGCTCATGACGAGGCTGTGGACATGGATATGTCACCCAAAGAGGCAGCTCCAGTC
TCTACAAAGCCTGATGTCACGTCAGCTCAATATCTACATTTATCCAACCATCAGACGCAAGAATCAACAAACTTG
GTCGATGACGACTTGGACGAGGAATTTGTGGATGCTAGAAGCAATCCAGCTCTATCATCACCTATTTCGAGGAGT
GTTGCAGCCGACAAAAGCGGTGCTGAGAAGGAAATCAAAGTAGCTTCATTTGAAATTAGCGAAATTGAGGAGGAT
CATTTCGAGCATTTGCTTACTGAAGTGGAGGCGCGATGCAAACTGCAAGGCGCGTCTAGAGCACAGCACGAGAGC
GAGGGAGATGAGGACCCAACCGAGTCACAGATTGTGGTGGCGACTGAGGAACTCCCTCTGGCTAGATGCAGCAAG
CGCGAGCGATACACGCCATCACCAAGCAAAGGGTCTGGACGGACAAGGCGCCAGAAATGGACATCTCCGGTCTCC
CCAAGGACGCCGACCAAGGTCACTGGTCAGGACGAGGGATCCGGAAGTAAGCACAAGAGAAAACGGGGCGAGAAG
CGGCATCATGACGTTCGGTCAAGCAAGAGAAGGCGGTCCATAACGTCAGTCTCAAACCAGTCAGCCGAGGGCAAG
ACTGGCTCTCTGGGGCCCGAGTTGAGCCCGTGCGCTCGCAAAGCACCGGCCAAGGCGGTACGAAGAAGTTTGCGT
CACCGGAAACAATCAGCAACAGATGTGCAAGACTTAGATGCCGCATCTTCTCCAGCAAGCAAAGCCTCTGACCGC
GACAAGTCAAATGAGTATGAAGGGCCAGAGCAGGGCGACACTGACGAGGAAGTCTTGTCCCAGCTGGTTACGGAA
TCCGCTGCAGCCTCACAGCAGAGCCACAACTCGCAACCAGCCCCATTGGGAGTGGTAACGAGGGCTCAAACACTG
GCAGGTGCTTCAGTGGCAGGGATCAATAAATCGGCACCAGCTGACGAGGAGAGAGCCCGGGATGGCAAGACGGGC
ATTATTAAGACTCTGCGGAGTGGACTAGATCAGCTACGCAAGGCAGCTCTTGGGAGAGAGGCGGTGTATGAGTTG
GAAGACGTGCTCATGGATATCAAGCGCGAACTATACGAGGCGGAGCTGAGGGGAAGAAGAAAGGGAGGCAGTTTT
GCTATTATTCATTAG
Gene >OphauB2|4514
ATGGCATCTTGTGCAGCCCCGGCCTCAAACCTTTTGGCTTCTCTTCCTGCTCGGCCGCCAACTCCTCCACGCGAA
ACCAATCACAACGCCGATGCTGCCTCTCTGCTTCGGTCTCTGGCGTTCAACCGCTCCCAGGCTTTCGACCCCCGC
CACAGCTTTCAGACGCCCCCAAGTACCATCTCGCCCGTCTCATCTTCTGCCAATTCCATCTCGAGCTCGCGTCGT
CGCCGCAAAAAGGTGGAGTGGTCCAATCATACTCAATACAAGGATCCTCCTGAGTATCTCAACGGCTCTCGTCTC
ACTCCTCCTTGCCCGATTTCCGTTCCACCGTCAGCCTCGTTGCAACCCATAAAAGGCATTCTCAAGCCCTCCTCT
CCGCTTCATCTTGGCTCCTCTGAGAACAGCAGCTTGCATGGCGTTTTTCCTCAGCTTGATCTCCTCGAAATGCTC
GAATCTACCATAAAGCAGCTCGCCGGCTCGGACCGGGACTCGAAACTCGACGCCTATATGATGCTTAGCAGGGCC
CTCAAAGCCTCCGACAACCTGCCTGATCGTGTTGCCCTCCGGAATAAGATGACACTATTCATGCAATTCATCCAG
CGCGATGTTGTAGCCAGGAATGAAGATGGCTCTCTCGACGCATCTCTTATCAACCACGCTCTCGTTTTGCTTGTC
ACCTTGCTCCATTACCAGGCCATAGCGTCTACCCTGACTTATGATTTTGGTGTCTTCATGCTAGACCATGCCATA
CGATGCTTTCAGGACTCTTCTACTCCCAAGGACATCGTTGGACATGTGATGCAGATTGTTGCATTTCAGGATTTC
TCTATCAAGGTCATGACGGCGGATCGTGTCGGCCGGCTTGTTGGCGCCCTACACAATATTGAGCGTCATGTTCAA
GGAAAAAGCATTGTGTGTGGGCGACTCCTCGTCTACAACAAACTGGTCAAGCAAGCTCGAAGCAATATCATCATT
CACTCGGACTGGCTCAAAGACATGTTCAACGACATGTTGAGCAGCATCAAAGATATCCGTGCCAAAGCCATATCC
CTGGGAACTGAGGCAGGATTTGCTCTTCGTTCTGATAGACGCTTGTTCCGCAAAGTCGCAGAGATTTTCGAGGCA
AGAAACGGTGACCAAGAGAAAGATGAGAGCTACATCGAGTTCTACATCAAGCGGCTCAGGGCCATGCTGGAGGAG
AGACAAACTAGTCATGCTGTTCCTCAGATCTTGGCTGTCGTCATTCTCTTCATGCGCTGTCCTCTCAATGAGTGG
AAGCTTTATAGCCAGTGGCTCACTCTAGTCCAGGCAGCATTCAACAAGGCCGATCTCCAGACCAAGCAAGAAGCA
AACTTCGCTTGGAATTGCTATGCATATCTGTCCATCATGGATAGCAAACCGTCGCCCAAGATGCTCACGAGGCTA
TGTCAACCTCTTCTGGCCCAGCTAAAAAGAAAGGCCAACCCCAAGCAAATGGAAGCGGCTCTGAGATTGCGCGAT
GTTGTTGTGGGGGGCTTGTGCAACTTGTACAGTCACGTCCTGGCGCAACGAGATAATCAACAATTCGCAGATGAC
ATGGTCTGGGATGTCGTGGTGCAGCCAGCCTTGTCCCAACTAATTGTTCTAGAGAGCACACCAGATGTTCCCAAA
GGCTGCACGGCAATTTTGTGTCGCATCCTCACCGGCGTTCTGGATACCTCGCGTCGCTTGCGTCGAAGCCTTGAT
AGCAACCTTAACTTGACACCACTAACTCCTGAGGAGCTGATGCCAATAGATTCAAAATGGGTTCGAAGAAACTGT
GACAAAGTCTATCAAGTGGCAGGTCCAATTCTCGAAAGCAACCTTATAGACTTGGCGGACGAACAGAGCCAAACA
TTGAAACTCTGGAAAGCTTTTGTCGGAGCCATAGCCATGGCATCTGCCAAAGATATCAAAGTCTCAGATGAGACA
GCAACATTTGTTGCAATCAGTTTAAGCAGACTATCCAGGATATGGACTCAAGGTCTTGGACAAGGCGACGGCTTT
ACTGAATTGGGTTTCTTAACTAGCGTTGGGCAGTTTGTCAATGTCTTGGTTCAATCTCTTGGTCTGTTACCATTT
ACTGAGAAGAAGCTCTGCATGAACGGACCCAATACCTTTCAAACAGTCGTCACACCGTCACGGCGAGCAGGCAAG
AATTCAGACTCTCGGGCTGCGTCGCGCATACCGTTGCATCACTTGTTTCTCATGCTGTCGTCAAATTGTCGAGGG
ATTGATGATGAAGAAGCACTGGCCAGTATGTTCATCTCGATTTTTCAGCCGTTCTTCGAGAATCGCGACACCACC
AACCGCAAGGAGCTGGCTCGGGAATTGATTCATCTTGTGCCGCGAAATTGCCTCTCTCCTTTTGGACCCTGGGTT
CTTGCGGCAGAGAATATGAAACCCTGGCTGGATCAAATGAATGCCGATAACGGATCGCTTCCCCCAAGTAGCAAT
ACATTCTTGGGTCCAGACTTTCGAGAAGTAGTGGCTCTTCTTGAGCGTGGCCTAATGTGCCATCCCAATTTGCCC
GTCAGACATTGGAGGCCACTGTTTGATTCTATTTCAACCGCAGTGGCACAAGGATACGGCGACGCTGGCCGTGTT
CTGATACTTGTGGAGCCGCTGGCCAAAGTGTTGCTTGACGGCGCCGTTCATGACTCTGACCAGCCGTCAAACCTG
TCTCTCTCGGCAATGGCGATGTTATTCTCTGTTGCCAAGCTTCCGCGTGATCGACAAGCGCTTGACGCCGCCCGC
CAGCGCCTTTGGGGAGCAGCCAAGGGCAGACACGGCCCTTTCGATCCCTTGTGCAACCTCTACAAGCTTGGGAAT
CAAGGTTTGAAGAGGCTCTATCACCTTGGCTCCGACACAGAGTTGATTGCAGATGTGGCCTCGGTAATGGATGCC
GCAATTACCTTCTTGGACAAGTGTCTGCCTCAAGCTTCTATCAAGGTCATTTCCGACCTGCAAAATGGTATTTGC
CTATGGATAGAAGACGAAGAGGAAAAGGTTCCGCAAGACAAGTCACAAGACATTACCAAAACTGTAAGTGGCACA
GACGAGAGCCCTCGCTATCAATCCTTACTCCTGTCCAGAGCCATGACTAACCGACACAGATCTATCGCTTCTGGG
ATCACATCTGTCAAAAGATTACGTCTTGTGATCAGCTTGAAAGACAAGACGTGGACCAGATTGAGCCCGTCTTGA
CGGCTGCTTTCAAGAGTAAGCATGCCTACGTCCGTGACAAAGCCACAGATGTTTGGAATGCGCTTGGCGAGGGGA
ACAAAGAAATAGACTGCTCAGATAGCCTCAAGTCTATTCTTTCCTCTCTGCATACCAAGAGCATTCACGGCTTGC
AGAGTGCTGACTCGTCAGCTGCTGGCTTCGGTGCACAGACATCTTTGTTTGCCGATGCTCCGGATGACGATGCTC
TTATTGCACCCGCATCAGAGGCTTCAACTCGTGACGCTTCTGAAGCTACGGATGACAAAGATCGGGTACCCGAGC
CATCAAGTTCGAAGAAACGGCGTCGCGAAACGCCTACAGGGAGCCATGAAAAACCGGGCAAGAAGACGAGAGCCG
CACGACCTCGCCATCAAGACTCGCAGATTTTCTTCGTGGCTATTCCTGCTGGTGCTTCCACTGCCAATGAATCTC
AACATCTGACGGAGAATCAGATGGATGTTCGCCAAAGGCAAAGAGAGCAGGCTCTCTTGTACTCAGACATGGGCA
CCTCTTCTCCGCAAGACGTCGCGGAGGAAACCACGAAAACGGGCAAGCATGAACAAGTCGGCAGTGGTCAAAGTC
CTGCCGTGGAGACTACTCCGAGGAAGGAGAGATCATTTGACGATTTGATCTCTTCGACGCCCACGCCGAGACGAG
GGCAAACTCTGCCTGTCATAGATATGAACGACCCCCCTTCCTCGCCCCCAGTTCCTCGGCCATACCCACTCCTGT
CAGAAATTCAATCACGATCAAGAAGCAGTGCGGATATCAACAGCTGGGAATTCTCGTCACCAACCACTTCTCCCA
TTACAAAGCATCAAAGAGCTCCTGAGAGGAGCGCTTCTGTCACATCCAATCAAGATTTTAAGTTTGCAAAAGAAA
ATGAGGAACAGCAAGCTGTGCATGAAGCGCATATACATGCGGCCGAACCTCATAATAATGGTGGTGCTCATGACG
AGGCTGTGGACATGGATATGTCACCCAAAGAGGCAGCTCCAGTCTCTACAAAGCCTGATGTCACGTCAGCTCAAT
ATCTACATTTATCCAACCATCAGACGCAAGAATCAACAAACTTGGTCGATGACGACTTGGACGAGGAATTTGTGG
ATGCTAGAAGCAATCCAGCTCTATCATCACCTATTTCGAGGAGTGTTGCAGCCGACAAAAGCGGTGCTGAGAAGG
AAATCAAAGTAGCTTCATTTGAAATTAGCGAAATTGAGGAGGATCATTTCGAGCATTTGCTTACTGAAGTGGAGG
CGCGATGCAAACTGCAAGGCGCGTCTAGAGCACAGCACGAGAGCGAGGGAGATGAGGACCCAACCGAGTCACAGA
TTGTGGTGGCGACTGAGGAACTCCCTCTGGCTAGATGCAGCAAGCGCGAGCGATACACGCCATCACCAAGCAAAG
GGTCTGGACGGACAAGGCGCCAGAAATGGACATCTCCGGTCTCCCCAAGGACGCCGACCAAGGTCACTGGTCAGG
ACGAGGGATCCGGAAGTAAGCACAAGAGAAAACGGGGCGAGAAGCGGCATCATGACGTTCGGTCAAGCAAGAGAA
GGCGGTCCATAACGTCAGTCTCAAACCAGTCAGCCGAGGGCAAGACTGGCTCTCTGGGGCCCGAGTTGAGCCCGT
GCGCTCGCAAAGCACCGGCCAAGGCGGTACGAAGAAGTTTGCGTCACCGGAAACAATCAGCAACAGATGTGCAAG
ACTTAGATGCCGCATCTTCTCCAGCAAGCAAAGCCTCTGACCGCGACAAGTCAAATGAGTATGAAGGGCCAGAGC
AGGGCGACACTGACGAGGAAGTCTTGTCCCAGCTGGTTACGGAATCCGCTGCAGCCTCACAGCAGAGCCACAACT
CGCAACCAGCCCCATTGGGAGTGGTAACGAGGGCTCAAACACTGGCAGGTGCTTCAGTGGCAGGGATCAATAAAT
CGGCACCAGCTGACGAGGAGAGAGCCCGGGATGGCAAGACGGGCATTATTAAGACTCTGCGGAGTGGACTAGATC
AGCTACGCAAGGCAGCTCTTGGGAGAGAGGCGGTGTATGAGTTGGAAGACGTGCTCATGGATATCAAGCGCGAAC
TATACGAGGCGGAGCTGAGGGGAAGAAGAAAGGGAGGCAGTTTTGCTATTATTCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail