Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4509
Gene name
LocationContig_3:348658..350239
Strand-
Gene length (bp)1581
Transcript length (bp)1350
Coding sequence length (bp)1350
Protein length (aa) 450

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01399 PCI PCI domain 1.2E-10 317 440

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SD63|CSN12_NEUCR Protein CSN12 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-8 PE=3 SV=2 1 449 0.0E+00
sp|Q4IMN9|CSN12_GIBZE Protein CSN12 homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CSN12 PE=3 SV=2 1 449 0.0E+00
sp|Q4WJX0|CSN12_ASPFU Protein CSN12 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=csn12 PE=3 SV=1 1 449 1.0E-167
sp|O13873|CSN12_SCHPO Protein CSN12 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csn12 PE=3 SV=1 119 445 1.0E-68
sp|Q4P8T5|CSN12_USTMA Protein CSN12 homolog OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CSN12 PE=3 SV=1 93 446 2.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SD63|CSN12_NEUCR Protein CSN12 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-8 PE=3 SV=2 1 449 0.0E+00
sp|Q4IMN9|CSN12_GIBZE Protein CSN12 homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CSN12 PE=3 SV=2 1 449 0.0E+00
sp|Q4WJX0|CSN12_ASPFU Protein CSN12 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=csn12 PE=3 SV=1 1 449 1.0E-167
sp|O13873|CSN12_SCHPO Protein CSN12 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csn12 PE=3 SV=1 119 445 1.0E-68
sp|Q4P8T5|CSN12_USTMA Protein CSN12 homolog OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CSN12 PE=3 SV=1 93 446 2.0E-61
sp|Q6C1L4|CSN12_YARLI Protein CSN12 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CSN12 PE=3 SV=1 115 445 4.0E-54
sp|P0CR48|CSN12_CRYNJ Protein CSN12 homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CSN12 PE=3 SV=1 116 445 7.0E-49
sp|P0CR49|CSN12_CRYNB Protein CSN12 homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CSN12 PE=3 SV=1 116 445 7.0E-49
sp|Q5JVF3|PCID2_HUMAN PCI domain-containing protein 2 OS=Homo sapiens GN=PCID2 PE=1 SV=2 87 445 2.0E-48
sp|Q5FWP8|PCID2_XENLA PCI domain-containing protein 2 OS=Xenopus laevis GN=pcid2 PE=2 SV=1 69 445 3.0E-46
sp|Q8BFV2|PCID2_MOUSE PCI domain-containing protein 2 OS=Mus musculus GN=Pcid2 PE=1 SV=1 87 445 1.0E-45
sp|Q5U3P0|PCID2_DANRE PCI domain-containing protein 2 OS=Danio rerio GN=pcid2 PE=2 SV=1 69 445 5.0E-44
sp|Q2TBN6|PCID2_BOVIN PCI domain-containing protein 2 OS=Bos taurus GN=PCID2 PE=2 SV=1 87 445 2.0E-42
sp|Q8GWE6|EER5_ARATH Enhanced ethylene response protein 5 OS=Arabidopsis thaliana GN=EER5 PE=1 SV=1 1 445 2.0E-34
sp|Q54PX7|PCID2_DICDI PCI domain-containing protein 2 homolog OS=Dictyostelium discoideum GN=pcid2 PE=3 SV=1 175 445 9.0E-33
sp|Q9VTL1|PCID2_DROME PCI domain-containing protein 2 homolog OS=Drosophila melanogaster GN=PCID2 PE=1 SV=2 69 449 1.0E-32
sp|Q75BU2|CSN12_ASHGO COP9 signalosome complex subunit 12 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSN12 PE=3 SV=2 160 445 3.0E-30
sp|Q60YJ7|PCID2_CAEBR PCI domain-containing protein 2 homolog OS=Caenorhabditis briggsae GN=CBG18211 PE=3 SV=1 115 445 2.0E-28
sp|Q95QU0|PCID2_CAEEL PCI domain-containing protein 2 homolog OS=Caenorhabditis elegans GN=C27F2.10 PE=3 SV=1 115 445 4.0E-25
sp|Q9Y820|YON7_SCHPO PCI domain-containing protein C1105.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1105.07c PE=4 SV=1 66 444 5.0E-23
sp|Q6BGR7|CSN12_DEBHA Protein CSN12 homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CSN12 PE=3 SV=2 179 446 7.0E-23
sp|Q6CPB1|CSN12_KLULA COP9 signalosome complex subunit 12 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CSN12 PE=3 SV=1 104 446 4.0E-22
sp|P47130|CSN12_YEAST Cop9 signalosome complex subunit 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSN12 PE=1 SV=1 160 447 2.0E-21
sp|Q6FJ48|CSN12_CANGA COP9 signalosome complex subunit 12 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CSN12 PE=3 SV=1 170 445 9.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2025
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4667
Ophiocordyceps australis map64 (Brazil) OphauB2|4509 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03297
Ophiocordyceps camponoti-rufipedis Ophun1|6177
Ophiocordyceps kimflemingae Ophio5|3540
Ophiocordyceps subramaniannii Hirsu2|2289

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4509
MDELFNEFAKAHAVRNGYALAQTLSPPSDAQKLRRIYESTNAHSAKSDARHFIKSKASLSHEEATGWIEVYTAYW
NALGEIMNTDSGKSTWTKTYEAWRDVTSVLVRGYNNHGFEAWTIPSLYVVGKYLRLFAIKSDDERSRSTADAPGE
ASLIQDDFDSEVAKQAQLRDCEQHLKRIFTLCLNDRAPLEESRKWGIYFVINLLFKTYFKLNSASLSRTILKALA
AYNEKGDMPPLESFPRAQRVTFKYYEGVLFFLEENYIQAEKHLTEAWLLCHKDASANLERILTYLIPCKLLTRHV
LPTSKLLEPFPHLQELFLPLCRCIKRGELTAFDLALQQRENELVKRRIYLTLERGRDIALRNLLRRVFVAGGFET
PKDSNTVPVRRTRVPVAEFRAAIGMNSGGELIESDEVECLLANMIYKDLMKGYIARERGIVVLSKKGAFPGTGV*
Coding >OphauB2|4509
ATGGACGAGCTATTCAACGAGTTCGCCAAGGCTCATGCCGTACGAAACGGATATGCACTCGCACAAACCCTTTCA
CCACCGAGCGACGCTCAGAAATTGCGCAGAATATATGAGAGCACCAACGCTCACAGTGCAAAAAGCGATGCCAGG
CACTTTATTAAATCCAAGGCAAGCTTGAGTCACGAGGAGGCCACAGGCTGGATTGAGGTATACACTGCCTACTGG
AACGCTCTTGGCGAGATCATGAATACAGACTCTGGCAAGTCGACGTGGACCAAAACGTACGAGGCGTGGAGAGAT
GTTACATCGGTACTAGTCCGAGGATACAACAATCACGGCTTCGAGGCCTGGACCATACCCAGCCTCTATGTAGTG
GGAAAATATCTGAGACTGTTTGCCATTAAATCCGACGATGAGCGTAGCCGCAGCACTGCGGATGCCCCTGGTGAG
GCCAGCCTCATACAAGATGACTTTGATTCAGAGGTCGCCAAACAAGCACAACTGAGAGATTGCGAGCAACATCTG
AAGCGTATTTTCACGCTTTGTCTTAATGACAGAGCCCCTCTAGAGGAGTCGCGCAAATGGGGCATATACTTCGTC
ATCAACTTACTCTTCAAGACTTACTTCAAGCTGAATTCAGCGTCGCTGTCTAGAACCATCTTGAAAGCGCTGGCC
GCGTATAATGAGAAGGGTGACATGCCGCCACTGGAAAGCTTTCCAAGGGCTCAAAGAGTAACATTCAAATACTAC
GAAGGCGTACTCTTCTTTCTTGAGGAAAATTACATTCAAGCAGAGAAGCACCTCACAGAGGCTTGGCTACTGTGC
CACAAAGACGCTTCTGCAAACTTGGAACGCATTCTTACATATCTCATCCCTTGCAAACTACTCACACGCCACGTC
CTCCCAACTTCAAAACTTTTGGAGCCATTTCCTCACTTACAGGAGCTTTTCCTCCCTCTTTGCCGATGCATAAAG
CGAGGCGAACTTACGGCCTTTGATTTGGCTCTACAGCAACGCGAGAATGAGCTTGTCAAGCGACGTATTTACTTG
ACACTAGAACGCGGCCGTGATATAGCCCTTCGCAATCTTCTGCGTCGAGTCTTTGTTGCCGGCGGCTTCGAAACA
CCAAAAGATTCCAATACAGTACCAGTGCGGCGGACGCGAGTACCAGTTGCCGAGTTCCGTGCCGCTATAGGCATG
AACAGTGGTGGAGAGCTCATCGAGTCGGACGAGGTTGAGTGTCTGCTGGCAAATATGATCTACAAGGATTTGATG
AAAGGTTATATTGCTCGAGAGCGAGGAATCGTCGTTTTGTCTAAAAAAGGAGCATTTCCTGGGACTGGAGTATAG
Transcript >OphauB2|4509
ATGGACGAGCTATTCAACGAGTTCGCCAAGGCTCATGCCGTACGAAACGGATATGCACTCGCACAAACCCTTTCA
CCACCGAGCGACGCTCAGAAATTGCGCAGAATATATGAGAGCACCAACGCTCACAGTGCAAAAAGCGATGCCAGG
CACTTTATTAAATCCAAGGCAAGCTTGAGTCACGAGGAGGCCACAGGCTGGATTGAGGTATACACTGCCTACTGG
AACGCTCTTGGCGAGATCATGAATACAGACTCTGGCAAGTCGACGTGGACCAAAACGTACGAGGCGTGGAGAGAT
GTTACATCGGTACTAGTCCGAGGATACAACAATCACGGCTTCGAGGCCTGGACCATACCCAGCCTCTATGTAGTG
GGAAAATATCTGAGACTGTTTGCCATTAAATCCGACGATGAGCGTAGCCGCAGCACTGCGGATGCCCCTGGTGAG
GCCAGCCTCATACAAGATGACTTTGATTCAGAGGTCGCCAAACAAGCACAACTGAGAGATTGCGAGCAACATCTG
AAGCGTATTTTCACGCTTTGTCTTAATGACAGAGCCCCTCTAGAGGAGTCGCGCAAATGGGGCATATACTTCGTC
ATCAACTTACTCTTCAAGACTTACTTCAAGCTGAATTCAGCGTCGCTGTCTAGAACCATCTTGAAAGCGCTGGCC
GCGTATAATGAGAAGGGTGACATGCCGCCACTGGAAAGCTTTCCAAGGGCTCAAAGAGTAACATTCAAATACTAC
GAAGGCGTACTCTTCTTTCTTGAGGAAAATTACATTCAAGCAGAGAAGCACCTCACAGAGGCTTGGCTACTGTGC
CACAAAGACGCTTCTGCAAACTTGGAACGCATTCTTACATATCTCATCCCTTGCAAACTACTCACACGCCACGTC
CTCCCAACTTCAAAACTTTTGGAGCCATTTCCTCACTTACAGGAGCTTTTCCTCCCTCTTTGCCGATGCATAAAG
CGAGGCGAACTTACGGCCTTTGATTTGGCTCTACAGCAACGCGAGAATGAGCTTGTCAAGCGACGTATTTACTTG
ACACTAGAACGCGGCCGTGATATAGCCCTTCGCAATCTTCTGCGTCGAGTCTTTGTTGCCGGCGGCTTCGAAACA
CCAAAAGATTCCAATACAGTACCAGTGCGGCGGACGCGAGTACCAGTTGCCGAGTTCCGTGCCGCTATAGGCATG
AACAGTGGTGGAGAGCTCATCGAGTCGGACGAGGTTGAGTGTCTGCTGGCAAATATGATCTACAAGGATTTGATG
AAAGGTTATATTGCTCGAGAGCGAGGAATCGTCGTTTTGTCTAAAAAAGGAGCATTTCCTGGGACTGGAGTATAG
Gene >OphauB2|4509
ATGGACGAGCTATTCAACGAGTTCGCCAAGGCTCATGCCGTACGAAACGGATATGCACTCGCACAAACCCTTTCA
CCACCGAGCGACGCTCAGAAATTGCGCAGAATATATGAGAGCACCAACGCTCACAGTGCAAAAAGCGATGCCAGG
CACTTTATTAAATCCAAGGCAAGCTTGAGTCACGAGGAGGCCACAGGCTGGATTGAGGTATACACTGCCTACTGG
AACGCTCTTGGCGAGATCATGAATACAGACTCTGGCAAGGTAAAGAAGCCTTTCCAAAGTCAAGACGTAGGGAGC
CATTTTGCTCATGAACCGCAGTCGACGTGGACCAAAACGTACGAGGCGTGGAGAGATGTTACATCGGTACTAGTC
CGAGGATACAACAATCACGGCTTCGAGGCCTGGACCATACCCAGCCTCTATGTAGTGGGAAAATATCTGAGACTG
TTTGCCATTAAATCCGACGATGAGCGTAGCCGCAGCACTGCGGATGCCCCTGGTGAGGCCAGCCTCATACAAGAT
GACTTTGATTCAGAGGTCGCCAAACAAGCACAACTGAGAGATTGCGAGCAACATCTGAAGCGTATTTTCACGCTT
TGTCTTAATGACAGGTGGGGTTGCCTCACCAAGTCTTCCAAGCTGAAGCTGACGACTGTGGCACGGCAGAGCCCC
TCTAGAGGAGTCGCGCAAATGGGGCATATACTTCGTCATCAACTTACTCTTCAAGACTTACTTCAAGCTGAATTC
AGCGTCGCTGTCTAGAACCATCTTGAAAGCGCTGGCCGCGTATAATGAGAAGGGTGACATGCCGCCACTGGAAAG
CTTTCCAAGGGCTCAAAGAGTAACATTCAAATACTACGAAGGCGTACTCTTCTTTCTTGAGGAAAATTACATTCA
AGCAGAGAAGCACCTCACAGAGGCTTGGCTACTGTGCCACAAAGACGCTTCTGCAAACTTGGAGTATACATTCAT
CTGCGCTACTATGCGAAACAGACGGCTGCTAATACTTGATAGACGCATTCTTACATATCTCATCCCTTGCAAACT
ACTCACACGCCACGTCCTCCCAACTTCAAAACTTTTGGAGCCATTTCCTCACTTACAGGAGCTTTTCCTCCCTCT
TTGCCGATGCATAAAGCGAGGCGAACTTACGGCCTTTGATTTGGCTCTACAGCAACGCGAGAATGAGCTTGTCAA
GCGACGTATTTACTTGACACTAGAACGCGGCCGTGATATAGCCCTTCGCAATCTTCTGCGTCGAGTCTTTGTTGC
CGGCGGCTTCGAAACACCAAAAGATTCCAATACAGTACCAGTGCGGCGGACGCGAGTACCAGTTGCCGAGTTCCG
TGCCGCTATAGGCATGAACAGTGGTGGAGAGCTCATCGAGTCGGACGAGGTTGAGTGTCTGCTGGCAAATATGAT
CTACAAGGTTAGTCGAAAAGGTCACAGTACATGCGATGAGAGCTATTTGCTGACAGCGCCGACGGCAAATAGGAT
TTGATGAAAGGTTATATTGCTCGAGAGCGAGGAATCGTCGTTTTGTCTAAAAAAGGAGCATTTCCTGGGACTGGA
GTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail