Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4508
Gene name
LocationContig_3:347867..348203
Strand+
Gene length (bp)336
Transcript length (bp)336
Coding sequence length (bp)336
Protein length (aa) 112

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup318
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4668
Ophiocordyceps australis map64 (Brazil) OphauB2|4508 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03298
Ophiocordyceps camponoti-floridani Ophcf2|04570
Ophiocordyceps camponoti-rufipedis Ophun1|2502
Ophiocordyceps camponoti-rufipedis Ophun1|6176
Ophiocordyceps kimflemingae Ophio5|3539
Ophiocordyceps kimflemingae Ophio5|7149
Ophiocordyceps subramaniannii Hirsu2|2290
Ophiocordyceps subramaniannii Hirsu2|3753

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4508
MYDDVVERISLPNEEPEAFDSVLQYLCSGDYYPRLVHNEQQDSWELEASDINHGILYHPGFDMDVLKDTVVYCSA
NKYGLEDLKDLALRKQALCTHGLILTITASLVCAFG*
Coding >OphauB2|4508
ATGTATGACGACGTTGTCGAGCGCATTTCTCTTCCCAACGAAGAACCCGAGGCCTTTGACTCTGTTCTCCAGTAC
CTATGCAGTGGCGATTACTATCCTCGCCTGGTGCACAACGAGCAACAAGACTCATGGGAGCTCGAGGCCAGTGAT
ATCAACCACGGTATACTATATCACCCAGGCTTCGATATGGACGTCCTCAAGGACACTGTTGTCTACTGCTCAGCC
AACAAATACGGACTCGAGGACCTCAAAGACTTGGCGTTGCGCAAGCAAGCCCTTTGTACGCATGGCCTTATACTC
ACTATTACCGCTTCCCTTGTTTGTGCCTTTGGCTGA
Transcript >OphauB2|4508
ATGTATGACGACGTTGTCGAGCGCATTTCTCTTCCCAACGAAGAACCCGAGGCCTTTGACTCTGTTCTCCAGTAC
CTATGCAGTGGCGATTACTATCCTCGCCTGGTGCACAACGAGCAACAAGACTCATGGGAGCTCGAGGCCAGTGAT
ATCAACCACGGTATACTATATCACCCAGGCTTCGATATGGACGTCCTCAAGGACACTGTTGTCTACTGCTCAGCC
AACAAATACGGACTCGAGGACCTCAAAGACTTGGCGTTGCGCAAGCAAGCCCTTTGTACGCATGGCCTTATACTC
ACTATTACCGCTTCCCTTGTTTGTGCCTTTGGCTGA
Gene >OphauB2|4508
ATGTATGACGACGTTGTCGAGCGCATTTCTCTTCCCAACGAAGAACCCGAGGCCTTTGACTCTGTTCTCCAGTAC
CTATGCAGTGGCGATTACTATCCTCGCCTGGTGCACAACGAGCAACAAGACTCATGGGAGCTCGAGGCCAGTGAT
ATCAACCACGGTATACTATATCACCCAGGCTTCGATATGGACGTCCTCAAGGACACTGTTGTCTACTGCTCAGCC
AACAAATACGGACTCGAGGACCTCAAAGACTTGGCGTTGCGCAAGCAAGCCCTTTGTACGCATGGCCTTATACTC
ACTATTACCGCTTCCCTTGTTTGTGCCTTTGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail