Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4507
Gene name
LocationContig_3:345690..346943
Strand+
Gene length (bp)1253
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q80UX8|ABHDD_MOUSE Alpha/beta hydrolase domain-containing protein 13 OS=Mus musculus GN=Abhd13 PE=2 SV=1 65 335 2.0E-15
sp|P54069|BEM46_SCHPO Protein bem46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bem46 PE=2 SV=3 152 377 4.0E-15
sp|Q6IRP4|ABHDD_XENLA Alpha/beta hydrolase domain-containing protein 13 OS=Xenopus laevis GN=abhd13 PE=2 SV=1 65 335 7.0E-15
sp|Q5ZJL8|ABHDD_CHICK Alpha/beta hydrolase domain-containing protein 13 OS=Gallus gallus GN=ABHD13 PE=2 SV=1 80 335 2.0E-14
sp|Q32LS6|ABHDD_DANRE Alpha/beta hydrolase domain-containing protein 13 OS=Danio rerio GN=abhd13 PE=2 SV=1 80 335 9.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q80UX8|ABHDD_MOUSE Alpha/beta hydrolase domain-containing protein 13 OS=Mus musculus GN=Abhd13 PE=2 SV=1 65 335 2.0E-15
sp|P54069|BEM46_SCHPO Protein bem46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bem46 PE=2 SV=3 152 377 4.0E-15
sp|Q6IRP4|ABHDD_XENLA Alpha/beta hydrolase domain-containing protein 13 OS=Xenopus laevis GN=abhd13 PE=2 SV=1 65 335 7.0E-15
sp|Q5ZJL8|ABHDD_CHICK Alpha/beta hydrolase domain-containing protein 13 OS=Gallus gallus GN=ABHD13 PE=2 SV=1 80 335 2.0E-14
sp|Q32LS6|ABHDD_DANRE Alpha/beta hydrolase domain-containing protein 13 OS=Danio rerio GN=abhd13 PE=2 SV=1 80 335 9.0E-14
sp|Q7L211|ABHDD_HUMAN Alpha/beta hydrolase domain-containing protein 13 OS=Homo sapiens GN=ABHD13 PE=2 SV=1 80 335 4.0E-12
sp|Q99LR1|ABD12_MOUSE Monoacylglycerol lipase ABHD12 OS=Mus musculus GN=Abhd12 PE=1 SV=2 144 344 2.0E-11
sp|Q6AYT7|ABD12_RAT Monoacylglycerol lipase ABHD12 OS=Rattus norvegicus GN=Abhd12 PE=2 SV=1 152 344 2.0E-11
sp|Q4R766|ABD12_MACFA Monoacylglycerol lipase ABHD12 OS=Macaca fascicularis GN=ABHD12 PE=2 SV=1 144 283 4.0E-11
sp|Q8N2K0|ABD12_HUMAN Monoacylglycerol lipase ABHD12 OS=Homo sapiens GN=ABHD12 PE=1 SV=2 152 283 6.0E-11
sp|Q08DW9|ABD12_BOVIN Monoacylglycerol lipase ABHD12 OS=Bos taurus GN=ABHD12 PE=2 SV=1 152 344 7.0E-11
sp|Q08C93|ABD12_DANRE Monoacylglycerol lipase ABHD12 OS=Danio rerio GN=abhd12 PE=2 SV=1 152 342 8.0E-11
sp|Q5ZIN0|ABD12_CHICK Monoacylglycerol lipase ABHD12 OS=Gallus gallus GN=ABHD12 PE=2 SV=1 152 344 1.0E-10
sp|B4F753|ABD12_XENTR Monoacylglycerol lipase ABHD12 OS=Xenopus tropicalis GN=abhd12 PE=2 SV=1 148 283 6.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

Domain # Start End Length
1 61 83 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4507
MHKACFIAAKKLESDNDHYQAAVMLSRMSFLTKSRSALMLKTPPVFLPLSTPWKRHFHPFVPPLLFTGLVIALYT
WKCLMLVVFQNFIIYNPFIPPDSRTVRIADFAKQCRGFEWREQHIKAIDGTQISLCTNDVETAGAASKARVPTYV
YIVYFQGNAASTPYRLPDITSILGIVRDLGPEEADVYSTVCLSYRGYWTSHDRPSERGINLDAMAALAYVERTHD
ERKAKNPNCKSVLVLWGQSIGSGFVTNLATSHADRSEMRMDALVLETPFTNTRDMLKALYPQRWLPYQYLWPFLR
TKLDSYKNLSRIAQLPPYRRPEIHIIEASQDELVPRDHGTILANRSRDVGLDVEHHRVPKALHNGVMTGNSGRHA
IARAITKAVHDAIHRQNGPDK*
Coding >OphauB2|4507
ATGCACAAGGCATGCTTTATAGCCGCCAAGAAGCTCGAGTCCGACAATGACCATTATCAGGCAGCAGTCATGCTG
AGTCGGATGTCTTTTTTGACCAAGTCTCGCTCGGCTCTCATGCTTAAGACTCCTCCTGTCTTCTTGCCTCTGTCG
ACTCCATGGAAGAGACACTTTCACCCATTTGTGCCGCCCCTCCTGTTCACCGGCCTTGTCATCGCGCTTTACACG
TGGAAGTGTTTGATGCTGGTTGTTTTCCAGAATTTTATCATATACAATCCATTCATTCCCCCAGACTCGCGGACC
GTGCGCATTGCCGATTTTGCGAAACAATGCCGTGGCTTTGAATGGCGTGAACAGCATATCAAAGCCATCGACGGC
ACACAGATTTCTCTCTGTACAAACGATGTTGAAACCGCTGGAGCAGCTAGCAAAGCGCGTGTCCCGACGTACGTT
TACATTGTCTACTTTCAAGGCAATGCGGCGTCTACGCCATACCGATTGCCTGATATTACATCCATTCTTGGCATC
GTACGAGACCTTGGGCCAGAAGAGGCCGACGTATATAGCACAGTTTGTCTAAGCTACCGTGGCTACTGGACGTCG
CATGACAGACCTTCGGAGCGCGGTATAAATCTAGATGCCATGGCAGCACTGGCATATGTTGAACGGACGCACGAC
GAAAGGAAGGCCAAAAACCCCAACTGCAAGTCTGTTCTGGTGCTTTGGGGACAAAGCATTGGCTCTGGCTTCGTC
ACGAATCTGGCGACCTCACATGCTGACCGGTCCGAAATGAGAATGGATGCTTTGGTGCTGGAAACGCCCTTCACC
AACACGCGAGACATGCTCAAGGCCCTGTATCCGCAACGCTGGCTTCCATATCAGTATCTTTGGCCCTTTCTACGC
ACAAAGCTCGACAGCTACAAGAATCTGAGCCGCATTGCTCAATTGCCGCCATATAGGCGCCCCGAGATTCATATC
ATTGAGGCAAGCCAGGACGAGCTTGTGCCACGCGATCACGGCACAATACTTGCCAACCGCAGCCGTGATGTGGGC
CTCGATGTTGAACATCACCGCGTGCCAAAGGCCCTTCACAATGGCGTCATGACGGGGAACAGTGGTAGACATGCC
ATTGCCCGCGCCATAACCAAGGCCGTACATGATGCTATACACCGTCAGAATGGTCCAGACAAGTAG
Transcript >OphauB2|4507
ATGCACAAGGCATGCTTTATAGCCGCCAAGAAGCTCGAGTCCGACAATGACCATTATCAGGCAGCAGTCATGCTG
AGTCGGATGTCTTTTTTGACCAAGTCTCGCTCGGCTCTCATGCTTAAGACTCCTCCTGTCTTCTTGCCTCTGTCG
ACTCCATGGAAGAGACACTTTCACCCATTTGTGCCGCCCCTCCTGTTCACCGGCCTTGTCATCGCGCTTTACACG
TGGAAGTGTTTGATGCTGGTTGTTTTCCAGAATTTTATCATATACAATCCATTCATTCCCCCAGACTCGCGGACC
GTGCGCATTGCCGATTTTGCGAAACAATGCCGTGGCTTTGAATGGCGTGAACAGCATATCAAAGCCATCGACGGC
ACACAGATTTCTCTCTGTACAAACGATGTTGAAACCGCTGGAGCAGCTAGCAAAGCGCGTGTCCCGACGTACGTT
TACATTGTCTACTTTCAAGGCAATGCGGCGTCTACGCCATACCGATTGCCTGATATTACATCCATTCTTGGCATC
GTACGAGACCTTGGGCCAGAAGAGGCCGACGTATATAGCACAGTTTGTCTAAGCTACCGTGGCTACTGGACGTCG
CATGACAGACCTTCGGAGCGCGGTATAAATCTAGATGCCATGGCAGCACTGGCATATGTTGAACGGACGCACGAC
GAAAGGAAGGCCAAAAACCCCAACTGCAAGTCTGTTCTGGTGCTTTGGGGACAAAGCATTGGCTCTGGCTTCGTC
ACGAATCTGGCGACCTCACATGCTGACCGGTCCGAAATGAGAATGGATGCTTTGGTGCTGGAAACGCCCTTCACC
AACACGCGAGACATGCTCAAGGCCCTGTATCCGCAACGCTGGCTTCCATATCAGTATCTTTGGCCCTTTCTACGC
ACAAAGCTCGACAGCTACAAGAATCTGAGCCGCATTGCTCAATTGCCGCCATATAGGCGCCCCGAGATTCATATC
ATTGAGGCAAGCCAGGACGAGCTTGTGCCACGCGATCACGGCACAATACTTGCCAACCGCAGCCGTGATGTGGGC
CTCGATGTTGAACATCACCGCGTGCCAAAGGCCCTTCACAATGGCGTCATGACGGGGAACAGTGGTAGACATGCC
ATTGCCCGCGCCATAACCAAGGCCGTACATGATGCTATACACCGTCAGAATGGTCCAGACAAGTAG
Gene >OphauB2|4507
ATGCACAAGGCATGCTTTATAGCCGCCAAGAAGCTCGAGTCCGACAATGACCATTATCAGGCAGCAGTCATGCTG
AGTCGGATGTCTTTTTTGACCAAGTCTCGCTCGGCTCTCATGCTTAAGACTCCTCCTGTCTTCTTGCCTCTGTCG
ACTCCATGGAAGAGACACTTTCACCCATTTGTGCCGCCCCTCCTGTTCACCGGCCTTGTCATCGCGCTTTACACG
TGGAAGTGTTTGATGCTGGTTGTTTTCCAGAATTTTATCATATACAATCCATTCATTCCCCCAGACTCGCGGACC
GTGCGCATTGCCGATTTTGCGAAACAATGCCGTGGCTTTGAATGGCGTGAACAGCATATCAAAGCCATCGACGGC
ACACAGATTTCTCTCTGTACAAACGATGTTGAAACCGCTGGAGCAGCTAGCAAAGCGCGTGTCCCGACGTACGTT
TACATTGTCTACTTTCAAGGTGCGTCTTTGGTCTGTCCCACTACATTAGATCGAAGCCCATAGTTTGTCGATTAA
CTTCAGGCAATGCGGCGTCTACGCCATACCGATTGCCTGATATTACATCCATTCTTGGCATCGTACGAGACCTTG
GGCCAGAAGAGGCCGACGTATATAGCACAGTTTGTCTAAGCTACCGTGGCTACTGGACGTCGCATGACAGACCTT
CGGAGCGCGGTATAAATCTAGATGCCATGGCAGCACTGGCATATGTTGAACGGACGCACGACGAAAGGAAGGCCA
AAAACCCCAACTGCAAGTCTGTTCTGGTGCTTTGGGGACAAAGCATTGGCTCTGGCTTCGTCACGAATCTGGCGA
CCTCACATGCTGACCGGTCCGAAATGAGAATGGATGCTTTGGTGCTGGAAACGCCCTTCACCAACACGCGAGACA
TGCTCAAGGCCCTGTATCCGCAACGCTGGCTTCCATATCAGTATCTTTGGCCCTTTCTACGCACAAAGCTCGACA
GCTACAAGAATCTGAGCCGCATTGCTCAATTGCCGCCATATAGGCGCCCCGAGATTCATATCATTGAGGCAAGCC
AGGACGAGCTTGTGCCACGCGATCACGGCACAATACTTGCCAACCGCAGCCGTGATGTGGGCCTCGATGTTGAAC
ATCACCGCGTGCCAAAGGCCCTTCACAATGGCGTCATGACGGGGAACAGTGGTAGACATGCCATTGCCCGCGCCA
TAACCAAGGCCGTACATGATGCTATACACCGTCAGAATGGTCCAGACAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail