Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|450
Gene name
LocationContig_106:54317..54701
Strand+
Gene length (bp)384
Transcript length (bp)384
Coding sequence length (bp)384
Protein length (aa) 128

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup618
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|731
Ophiocordyceps australis 1348a (Ghana) OphauG2|732
Ophiocordyceps australis map64 (Brazil) OphauB2|450 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|451
Ophiocordyceps camponoti-floridani Ophcf2|01245
Ophiocordyceps camponoti-rufipedis Ophun1|3246
Ophiocordyceps kimflemingae Ophio5|2206
Ophiocordyceps kimflemingae Ophio5|2207

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|450
MLPLRVTRATGLLHCKQLHTLPTRRLPYKNSQDRNSLRPQSAEHTKSARDDDASQATKAAFDPQTTSPEAETRQA
GDTLDASGANQALSKPRGDETDRHGQGAGKEVRKGGASGGASPPKGGSPGRV*
Coding >OphauB2|450
ATGCTTCCCCTCCGCGTCACCCGAGCTACGGGCTTGCTCCACTGCAAGCAGCTTCACACTTTGCCGACACGCCGC
CTGCCATACAAAAACTCGCAGGATCGCAACTCGCTGCGCCCCCAGTCAGCCGAGCACACAAAGTCTGCCCGCGAC
GACGATGCGTCCCAAGCCACCAAGGCGGCGTTTGATCCCCAGACTACAAGCCCCGAGGCCGAGACGCGGCAGGCG
GGAGACACACTTGATGCGAGTGGCGCAAATCAGGCGCTCAGCAAACCCAGGGGAGATGAGACGGACCGGCACGGA
CAGGGAGCCGGCAAAGAGGTTCGCAAGGGGGGTGCCAGTGGTGGTGCAAGCCCGCCCAAGGGAGGCTCTCCGGGA
CGTGTATAG
Transcript >OphauB2|450
ATGCTTCCCCTCCGCGTCACCCGAGCTACGGGCTTGCTCCACTGCAAGCAGCTTCACACTTTGCCGACACGCCGC
CTGCCATACAAAAACTCGCAGGATCGCAACTCGCTGCGCCCCCAGTCAGCCGAGCACACAAAGTCTGCCCGCGAC
GACGATGCGTCCCAAGCCACCAAGGCGGCGTTTGATCCCCAGACTACAAGCCCCGAGGCCGAGACGCGGCAGGCG
GGAGACACACTTGATGCGAGTGGCGCAAATCAGGCGCTCAGCAAACCCAGGGGAGATGAGACGGACCGGCACGGA
CAGGGAGCCGGCAAAGAGGTTCGCAAGGGGGGTGCCAGTGGTGGTGCAAGCCCGCCCAAGGGAGGCTCTCCGGGA
CGTGTATAG
Gene >OphauB2|450
ATGCTTCCCCTCCGCGTCACCCGAGCTACGGGCTTGCTCCACTGCAAGCAGCTTCACACTTTGCCGACACGCCGC
CTGCCATACAAAAACTCGCAGGATCGCAACTCGCTGCGCCCCCAGTCAGCCGAGCACACAAAGTCTGCCCGCGAC
GACGATGCGTCCCAAGCCACCAAGGCGGCGTTTGATCCCCAGACTACAAGCCCCGAGGCCGAGACGCGGCAGGCG
GGAGACACACTTGATGCGAGTGGCGCAAATCAGGCGCTCAGCAAACCCAGGGGAGATGAGACGGACCGGCACGGA
CAGGGAGCCGGCAAAGAGGTTCGCAAGGGGGGTGCCAGTGGTGGTGCAAGCCCGCCCAAGGGAGGCTCTCCGGGA
CGTGTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail