Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4498
Gene name
LocationContig_3:323802..324747
Strand-
Gene length (bp)945
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01876 RNase_P_p30 RNase P subunit p30 1.1E-50 3 211

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87120|RNP3_SCHPO Probable ribonuclease P protein subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A12.04c PE=3 SV=2 1 238 1.0E-27
sp|Q3SZ21|RPP30_BOVIN Ribonuclease P protein subunit p30 OS=Bos taurus GN=RPP30 PE=2 SV=1 25 241 1.0E-23
sp|O88796|RPP30_MOUSE Ribonuclease P protein subunit p30 OS=Mus musculus GN=Rpp30 PE=1 SV=1 18 241 1.0E-23
sp|P78346|RPP30_HUMAN Ribonuclease P protein subunit p30 OS=Homo sapiens GN=RPP30 PE=1 SV=1 18 241 2.0E-21
sp|Q3ZE13|RPP30_DICDI Ribonuclease P protein subunit drpp30 OS=Dictyostelium discoideum GN=drpp30 PE=2 SV=1 1 238 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87120|RNP3_SCHPO Probable ribonuclease P protein subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A12.04c PE=3 SV=2 1 238 1.0E-27
sp|Q3SZ21|RPP30_BOVIN Ribonuclease P protein subunit p30 OS=Bos taurus GN=RPP30 PE=2 SV=1 25 241 1.0E-23
sp|O88796|RPP30_MOUSE Ribonuclease P protein subunit p30 OS=Mus musculus GN=Rpp30 PE=1 SV=1 18 241 1.0E-23
sp|P78346|RPP30_HUMAN Ribonuclease P protein subunit p30 OS=Homo sapiens GN=RPP30 PE=1 SV=1 18 241 2.0E-21
sp|Q3ZE13|RPP30_DICDI Ribonuclease P protein subunit drpp30 OS=Dictyostelium discoideum GN=drpp30 PE=2 SV=1 1 238 1.0E-17
sp|P38786|RPP1_YEAST Ribonuclease P/MRP protein subunit RPP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPP1 PE=1 SV=1 1 225 7.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0008033 tRNA processing Yes
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0006399 tRNA metabolic process No
GO:0006396 RNA processing No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034470 ncRNA processing No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4498
MLYDLNIPWSPSTPTDQLIQTLSFAASLGYDTVALNHVLELPLAAHPKSPFPKLASDDSTTARKLPNILHRATVP
LVDASSSNFRLPALAAVYDLVAVRPLSEWAFQHACLSLDVPLISLDLTTHFPYHFRPRPCMAAVSRGVRFEISYA
QLLNADARGRANFIANLSALVRVTRGRGFVLSSAASDALFMRAPADAVNLMSVWGLASEKGLEGFRSLPRSLVVN
EGIKRSGFRGVVDIVQVASAPDAAATKPVQDDGSSTATTKPNNGQKRKSGAEQGAPQTLSKRQAKKMRLAERQQQ
STASLPPDKNKTPS*
Coding >OphauB2|4498
ATGCTCTACGACCTCAACATTCCTTGGTCGCCGTCCACTCCCACCGACCAACTCATCCAGACCCTCTCCTTTGCA
GCCTCTCTGGGCTATGACACCGTTGCCCTCAACCACGTCCTCGAGCTTCCTCTAGCCGCCCACCCAAAGTCTCCC
TTTCCCAAGCTTGCCTCTGATGACTCCACGACGGCCCGCAAGCTCCCCAACATTCTTCACCGAGCAACGGTCCCG
CTTGTCGATGCCTCATCGTCCAATTTCCGTCTCCCGGCCCTCGCTGCCGTCTACGACTTGGTGGCTGTCCGTCCC
CTCTCGGAATGGGCCTTTCAGCATGCCTGCCTCTCTCTAGACGTGCCTCTTATTTCCCTCGATCTCACGACCCAT
TTTCCCTATCATTTTCGCCCCCGGCCTTGTATGGCGGCCGTTTCGCGTGGCGTTCGATTCGAGATTTCATATGCG
CAGCTTCTTAATGCTGATGCGCGCGGGCGCGCAAACTTTATTGCCAATTTGTCGGCCCTTGTTCGCGTCACCCGT
GGCCGCGGCTTTGTACTCTCGAGCGCCGCTTCCGATGCTCTATTCATGCGGGCACCCGCAGATGCTGTAAATCTC
ATGTCTGTTTGGGGCCTCGCTTCTGAAAAAGGTCTCGAGGGCTTTCGTTCCTTGCCCCGAAGCCTGGTGGTCAAT
GAGGGCATCAAGAGGAGTGGTTTTCGCGGCGTTGTCGACATTGTGCAAGTGGCTTCTGCTCCTGACGCTGCAGCC
ACCAAGCCTGTGCAAGACGATGGTAGCTCGACAGCGACTACCAAGCCTAACAATGGGCAAAAACGAAAAAGTGGC
GCTGAACAGGGTGCTCCGCAGACCCTGAGCAAGCGGCAGGCCAAGAAGATGAGACTAGCAGAACGGCAACAGCAA
TCTACAGCGAGTTTACCACCAGACAAGAACAAAACCCCCTCGTGA
Transcript >OphauB2|4498
ATGCTCTACGACCTCAACATTCCTTGGTCGCCGTCCACTCCCACCGACCAACTCATCCAGACCCTCTCCTTTGCA
GCCTCTCTGGGCTATGACACCGTTGCCCTCAACCACGTCCTCGAGCTTCCTCTAGCCGCCCACCCAAAGTCTCCC
TTTCCCAAGCTTGCCTCTGATGACTCCACGACGGCCCGCAAGCTCCCCAACATTCTTCACCGAGCAACGGTCCCG
CTTGTCGATGCCTCATCGTCCAATTTCCGTCTCCCGGCCCTCGCTGCCGTCTACGACTTGGTGGCTGTCCGTCCC
CTCTCGGAATGGGCCTTTCAGCATGCCTGCCTCTCTCTAGACGTGCCTCTTATTTCCCTCGATCTCACGACCCAT
TTTCCCTATCATTTTCGCCCCCGGCCTTGTATGGCGGCCGTTTCGCGTGGCGTTCGATTCGAGATTTCATATGCG
CAGCTTCTTAATGCTGATGCGCGCGGGCGCGCAAACTTTATTGCCAATTTGTCGGCCCTTGTTCGCGTCACCCGT
GGCCGCGGCTTTGTACTCTCGAGCGCCGCTTCCGATGCTCTATTCATGCGGGCACCCGCAGATGCTGTAAATCTC
ATGTCTGTTTGGGGCCTCGCTTCTGAAAAAGGTCTCGAGGGCTTTCGTTCCTTGCCCCGAAGCCTGGTGGTCAAT
GAGGGCATCAAGAGGAGTGGTTTTCGCGGCGTTGTCGACATTGTGCAAGTGGCTTCTGCTCCTGACGCTGCAGCC
ACCAAGCCTGTGCAAGACGATGGTAGCTCGACAGCGACTACCAAGCCTAACAATGGGCAAAAACGAAAAAGTGGC
GCTGAACAGGGTGCTCCGCAGACCCTGAGCAAGCGGCAGGCCAAGAAGATGAGACTAGCAGAACGGCAACAGCAA
TCTACAGCGAGTTTACCACCAGACAAGAACAAAACCCCCTCGTGA
Gene >OphauB2|4498
ATGCTCTACGACCTCAACATTCCTTGGTCGCCGTCCACTCCCACCGACCAACTCATCCAGACCCTCTCCTTTGCA
GCCTCTCTGGGCTATGACACCGTTGCCCTCAACCACGTCCTCGAGCTTCCTCTAGCCGCCCACCCAAAGTCTCCC
TTTCCCAAGCTTGCCTCTGATGACTCCACGACGGCCCGCAAGCTCCCCAACATTCTTCACCGAGCAACGGTCCCG
CTTGTCGATGCCTCATCGTCCAATTTCCGTCTCCCGGCCCTCGCTGCCGTCTACGACTTGGTGGCTGTCCGTCCC
CTCTCGGAATGGGCCTTTCAGCATGCCTGCCTCTCTCTAGACGTGCCTCTTATTTCCCTCGATCTCACGACCCAT
TTTCCCTATCATTTTCGCCCCCGGCCTTGTATGGCGGCCGTTTCGCGTGGCGTTCGATTCGAGATTTCATATGCG
CAGCTTCTTAATGCTGATGCGCGCGGGCGCGCAAACTTTATTGCCAATTTGTCGGCCCTTGTTCGCGTCACCCGT
GGCCGCGGCTTTGTACTCTCGAGCGCCGCTTCCGATGCTCTATTCATGCGGGCACCCGCAGATGCTGTAAATCTC
ATGTCTGTTTGGGGCCTCGCTTCTGAAAAAGGTCTCGAGGGCTTTCGTTCCTTGCCCCGAAGCCTGGTGGTCAAT
GAGGGCATCAAGAGGAGTGGTTTTCGCGGCGTTGTCGACATTGTGCAAGTGGCTTCTGCTCCTGACGCTGCAGCC
ACCAAGCCTGTGCAAGACGATGGTAGCTCGACAGCGACTACCAAGCCTAACAATGGGCAAAAACGAAAAAGTGGC
GCTGAACAGGGTGCTCCGCAGACCCTGAGCAAGCGGCAGGCCAAGAAGATGAGACTAGCAGAACGGCAACAGCAA
TCTACAGCGAGTTTACCACCAGACAAGAACAAAACCCCCTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail